Home Page for S100A2

S100A2/S100L

Primary information about S100A2/S100L:
Basic chemical and physical information	Basic biological information	Basic genomic information	Metal ion binding constants	Interspecies sequence alignment	Information on function
Summary of structural studies	Information on the conformational change	List of available structures	Information about mutations	References about S100A2	Other web resources about S100A2
Additional information about S100A2/S100L:
Information about the evolutionary relationship of S100A2/S100L to other proteins

Basic Information

Basic Chemical and Physical Information:
Additional names and abbreviations:	S100A2: CaN19
Isoforms:	No information about isoforms is stored in the database
Yeast Protein Database Entries:	No links to the YPD are stored in the database

Number of amino acids:	97 (all species) View a list of all sources stored in the database
Molecular weight:	10.893 kD (Bos taurus) - 11.013 kD (Homo sapiens) View a list of all sources stored in the database
pI:	calculated pI (Homo sapiens) = 4.5 (InfoCard)
Number of functional calcium binding sites:	not yet available in the data library
Macroscopic calcium binding constants:	not yet available in the data library
Other metal binding constants:	not yet available in the data library
Protein stability:	not yet available in the data library
Post-translational modifications:	not yet available in the data library

Basic Biological Information:
Source organisms:	Bos taurus, Homo sapiens View an annotated list of all sources stored in the database
Tissues:	Bos taurus: kidney (InfoCard) Bos taurus: lung (InfoCard) Bos taurus: heart (InfoCard) Bos taurus: skeletal muscle (InfoCard)
Subcellular localization:	not yet available in the data library
Regulation:	not yet available in the data library

Genomic Information:
GenBank entries:	View a list of GenBank entries stored in the database
Gene length:	not yet available in the data library
Gene structure:	not yet available in the data library
Promoter:	not yet available in the data library
Gene copies:	not yet available in the data library
Alleles:	no alleles are currently stored in the data library
Chromosomal localization:	Homo sapiens, expressed (GenBank code Y07755): q21 region of chromosome 1 (part of the cluster of S100 protein genes) (InfoCard)

Interspecies Sequence Alignment



                |-helixI-|--loop1----|helixII|
            	 En**nn**nX**Y*Z**#Ix**zn**nn*n

HUMAN   : MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEE
BOVINE  : MSSPLEQALAVMVATFHKYSGQEGDKFKLSKGEMKELLHKELPSFVGEKVDEE


         |helixIII|--loop2----|helixIV|        
          En**nn**nX*Y*ZG#Ix**zn**nn*n 

HUMAN   : GLKKLMGNLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
BOVINE  : GLKKLMGDLDENSDQQVDFQEYAVFLALITIMCNDFFQGSPARS

Sequence alignment of the entire S100 subfamily

Functional Information:

General information:

no general functional information is currently stored in the database

Biological roles:

not yet available in the data library

Disease states:

breast cancer
in vivo evidence : Expression of S100A2 is down-regulated in mammary carcinoma cells and restored by treatment with a demethylating agent (InfoCard)

Target molecules:

not yet available in the data library

Structural Information:

Calcium-coordination:
not yet available in the data library

Nature of the conformational changes:
not yet available in the data library

Secondary structure: (as reported in the PDB file and its accompanying reference)
not yet available in the data library

Additional structural information:
no additional structural information is currently stored in the database

Available structures: (follow the links from the PDB code to the retrieve the PDB files)
no structures are currently stored in the database

Information about mutants:

no mutants are currently stored in the database