Home Page for S100A6

S100A6/Calcyclin

Primary information about S100A6/calcyclin:
Basic chemical and physical information	Basic biological information	Basic genomic information	Metal ion binding constants	Interspecies sequence alignment	Information on function
Summary of structural studies	Information on the conformational change	List of available structures	Information about mutations	References about S100A6	Other web resources about S100A6
Additional information about S100A6/calcyclin:
Information about the evolutionary relationship of S100A6/calcyclin to other proteins	Dihedral angles in the apo calcyclin dimer

Basic Information

Basic Chemical and Physical Information:
Additional names and abbreviations:	S100A6: 2A9; CACY; PRA; caltropin
Isoforms:	No information about isoforms is stored in the database
Yeast Protein Database Entries:	No links to the YPD are stored in the database

Number of amino acids:	89 (Mus musculus) - 92 (horse, Gallus gallus) View a list of all sources stored in the database
Molecular weight:	10.051 kD (Mus musculus) - 10.28 kD (horse) View a list of all sources stored in the database
pI:	experimental pI (Homo sapiens) = 5.25 (modification: recombinant protein (InfoCard) calculated pI (Homo sapiens) = 5.25 (InfoCard)
Number of functional calcium binding sites:	Homo sapiens: 2 (InfoCard)
Macroscopic calcium binding constants:	not yet available in the data library
Other metal binding constants:	not yet available in the data library
Protein stability:	not yet available in the data library
Post-translational modifications:	not yet available in the data library

Basic Biological Information:
Source organisms:	Gallus gallus, horse, Homo sapiens, Mus musculus, Oryctolagus cuniculus, Rattus norvegicus View an annotated list of all sources stored in the database
Tissues:	Gallus gallus: smooth muscle (InfoCard) Homo sapiens: platelets (InfoCard) Mus musculus: Ehrlich ascites tumor cells (InfoCard) Mus musculus: decidua (InfoCard) Mus musculus: brain (InfoCard) Oryctolagus cuniculus: lung (InfoCard)
Subcellular localization:	not yet available in the data library
Regulation:	not yet available in the data library

Genomic Information:
GenBank entries:	View a list of GenBank entries stored in the database
Gene length:	not yet available in the data library
Gene structure:	not yet available in the data library
Promoter:	not yet available in the data library
Gene copies:	not yet available in the data library
Alleles:	no alleles are currently stored in the data library
Chromosomal localization:	Homo sapiens, expressed (GenBank code J02763): q21 region of chromosome 1 (part of the cluster of S100 protein genes) (InfoCard) Mus musculus, expressed (GenBank code X66449): chromosome 3 (InfoCard)

Interspecies Sequence Alignment



                   |-helixA-|--loop1------|helixB| 
                    En**nn**nX**Y*Z**#Ix**zn**nn*n

RABBIT  : MASPLDQAIGLLIGIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQD
HUMAN   : MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD
MOUSE   : MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQD
RAT     : MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGAKLQD


          |-helixC-|--loop2----|helixD| 
           En**nn**nX*Y*ZG#Ix**zn**nn*n

RABBIT  : AEIVKLMDDLDRNKDQEVNFQEYITFLGALAMIYNEALKG          
HUMAN   : AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG         
MOUSE   : AEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK           
RAT     : AEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALKG

Sequence alignment for the entire S100 subfamily

Functional Information:

General information:

no general functional information is currently stored in the database

Biological roles:

calcium-dependent insulin release: is thought to stimulate this process
cell biological evidence in Rattus norvegicus: Calcium-stimulated insulin release by permeablized pancreatic islets was increased by exogenous calcyclin. Calcyclin did not increase insulin release in a low calcium environment. (InfoCard)
cell cycle progression: may be involved in this process
genetic evidence in Homo sapiens: S100A6 is preferentially expressed in the G1 phase of the cell cycle (InfoCard)
cell proliferation: thought to be involved in the regulation of this process in both normal and tumor tissues
biochemical evidence in : The S100A6 gene is induced by growth factors, oncogenes, phorbol esters, and retinoic acid (InfoCard)

Disease states:

leukemia
genetic evidence : Expression of the gene for S100A6 is increased in leukemia cells (InfoCard)
breast cancer
biochemical evidence : S100A6 is abundant in some breast cancer cell lines (InfoCard)

Target molecules:

not yet available in the data library

Structural Information:

Calcium-coordination:
not yet available in the data library

Nature of the conformational changes:
not yet available in the data library

Secondary structure: (as reported in the PDB file and its accompanying reference)
not yet available in the data library

Additional structural information:
View a table of interhelical angles from various structures View a table of hydrogen bonds observed in various structures

Available structures: (follow the links from the PDB code to the retrieve the PDB files)
Apo Structures:	1CNP: Oryctolagus cuniculus, homodimer, NMR solution structure, 22 models (InfoCard) 2CNP: Oryctolagus cuniculus, homodimer, NMR solution structure, 22 models (InfoCard)
Calcium Loaded Structures:	1A03: Oryctolagus cuniculus, homodimer, (InfoCard)

Information about mutants:

no mutants are currently stored in the database