| Additional names and abbreviations: | spectrin: calspectin; brain actin-binding protein (BABP) |
|---|---|
| Isoforms: | brain isoform alpha chain erythroid isoform alpha chain |
| Yeast Protein Database Entries: | No links to the YPD are stored in the database |
| Basic Chemical and Physical
Information: |
|
| Number of amino acids: | brain isoform alpha chain: 2472 (Homo sapiens) - 2477 (Gallus gallus) erythroid isoform alpha chain: 2415 (Drosophila melanogaster) - 2418 (Homo sapiens) View a list of all sources stored in the database |
| Molecular weight: | brain isoform alpha chain: 284.279 kD (Homo sapiens) - 285.361 kD (Gallus gallus) erythroid isoform alpha chain: 278.328 kD (Drosophila melanogaster) - 279.913 kD (Homo sapiens) View a list of all sources stored in the database |
| pI: | not yet available in the data library |
| Number of functional calcium binding sites: | not yet available in the data library |
| Macroscopic calcium binding constants: | not yet available in the data library |
| Other metal binding constants: | not yet available in the data library |
| Protein stability: | not yet available in the data library |
| Post-translational modifications: | not yet available in the data library |
| Basic Biological
Information: |
|
| Source organisms: | brain isoform alpha chain: Gallus gallus,
Homo sapiens
erythroid isoform alpha chain: Drosophila melanogaster, Homo sapiens View an annotated list of all sources stored in the database |
| Tissues: | not yet available in the data library |
| Subcellular localization: | not yet available in the data library |
| Regulation: | not yet available in the data library |
| Genomic Information: |
|
| GenBank entries: | not yet available in the data library |
| Gene length: | not yet available in the data library |
| Gene structure: | not yet available in the data library |
| Promoter: | not yet available in the data library |
| Gene copies: | not yet available in the data library |
| Alleles: | no alleles are currently stored in the data library |
| Chromosomal localization: | not yet available in the data library |
|-helixI-|--loop1----|helixII|
En**nn**nX*Y*ZG#Ix**zn**nn*n
CHICK : RNTTGVAEEALKEFSMMFKHFDKDKSGRLDHQEFKSCLRS
CHICK(NONERYTH): RNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRS
HUMAN(ERYTH) : KDIKGVSEETLKEFSTIYKHFDENLTGRLTHKEFRSCLRG
DROSOP : RNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCLRA
|helixIII|--loop2----|helixIV|
En**nn**nX*Y*ZG#Ix**zn**nn*n
CHICK : LGYDLPMVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFMISR
CHICK(NONERYTH): LGYDLPMVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFMISR
HUMAN(ERYTH) : LNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDK
DROSOP : LGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISK
Sequence alignment of the entire spectrin
alpha chains subfamily
General information:
Biological roles:
Disease states:
Target molecules:
| Calcium-coordination: |
|
|---|---|
| not yet available in the data library |
|
| Nature of the conformational
changes: |
|
| Conformational change between apo and two calcium ions bound states of brain isoform alpha chain: |
Spectrin exhibits calcium-dependent opening in a calmodulin-like manner. (InfoCard) |
| Secondary structure: (as reported in the PDB file and its accompanying reference) |
|
| not yet available in the data library |
|
| Additional structural information: | |
| no additional structural information is currently
stored in the database |
|
| Available structures: (follow the links from the PDB code to the retrieve the PDB files) |
|
| no structures are currently stored in the database |
|