Home Page for Sarcoplasmic Calcium Binding Protein

Sarcoplasmic Calcium Binding Protein

Primary information about sarcoplasmic calcium-binding protein:
Basic chemical and physical information	Basic biological information	Basic genomic information	Metal ion binding constants	Interspecies sequence alignment	Information on function
Summary of structural studies	Information on the conformational change	List of available structures	Information about mutations	References about sarcoplasmic calcium-binding protein	Other web resources about sarcoplasmic calcium-binding protein

Basic Information

Basic Chemical and Physical Information:
Additional names and abbreviations:	sarcoplasmic calcium-binding protein: sarcoplasmic calcium-binding protein (SCP)
Isoforms:	isoform I isoform II shrimp alpha chain shrimp beta chain
Yeast Protein Database Entries:	No links to the YPD are stored in the database

Number of amino acids:	isoform I: 185 (Branchiostoma lanceolatum) - 192 (Pontastacus leptodactylus) isoform II: 185 (all species) shrimp alpha chain: 192 (all species) shrimp beta chain: 192 (all species) 174 (Nereis diversicolor, Perinereis vancaurica tetradentata) - 176 (Patinopecten yessoensis) View a list of all sources stored in the database
Molecular weight:	isoform I: 21.418 kD (Branchiostoma lanceolatum) - 21.625 kD (Pontastacus leptodactylus) isoform II: 21.286 kD (all species) shrimp alpha chain: 21.979 kD (all species) shrimp beta chain: 21.967 kD (all species) 19.525 kD (Perinereis vancaurica tetradentata) - 21.625 kD (Nereis diversicolor) View a list of all sources stored in the database
pI:	experimental pI (Nereis diversicolor) = 4.8 (InfoCard)
Number of functional calcium binding sites:	isoform II, Branchiostoma lanceolatum: 3 (InfoCard) Nereis diversicolor: 3 (InfoCard)
Macroscopic calcium binding constants:	not yet available in the data library
Other metal binding constants:	not yet available in the data library
Protein stability:	not yet available in the data library
Post-translational modifications:	not yet available in the data library

Basic Biological Information:
Source organisms:	isoform I: Branchiostoma lanceolatum, Pontastacus leptodactylus isoform II: Branchiostoma lanceolatum shrimp alpha chain: Penaeus sp shrimp beta chain: Penaeus sp Nereis diversicolor, Patinopecten yessoensis, Perinereis vancaurica tetradentata View an annotated list of all sources stored in the database
Tissues:	not yet available in the data library
Subcellular localization:	not yet available in the data library
Regulation:	not yet available in the data library

Genomic Information:
GenBank entries:	not yet available in the data library
Gene length:	not yet available in the data library
Gene structure:	not yet available in the data library
Promoter:	not yet available in the data library
Gene copies:	not yet available in the data library
Alleles:	no alleles are currently stored in the data library
Chromosomal localization:	not yet available in the data library

Interspecies Sequence Alignment



                 |-helixI--|--loop1----|helixII|
                  En**nn**-nX*Y*ZG#Ix**zn**nn**n

AMPHIOX : GLNDFQKQKIKFTFDFFLDMNHDGSIQDNDFEDMMTRYKEVNKGSLSDADYKSMQASLED
NEREIS  : SDLWVQKMKTYFNR-IDFDKDGAITRMDFESMAERF---AKE---SEMKAEHAKVLMD


         |helixIII|--loop2----|helixIV|                   |-helixV-|-loop3
          En**nn**nX*Y*ZG#Ix**zn**nn**n                   En**nn**nX*Y*ZG

AMPHIOX : EWRDLKGRADINKDDVVSWEEYLAMWEKTIATCKSVADLP---AWCQNRIPFLFKGMDVSGDG
NEREIS  : SLTGVWDNF-LTAVAGGKGIDETTFINSM----KEMVKNPEAKSVVEGPLPLFFRAVDTNEDN

          -----|helixVI|       |helixVII|---loop4----|helixVIII|
          #Ix**zn**nn**n        En**nn**nX*-Y*ZG#Ix**zn**nn**n

AMPHIOX : IVDLEEFQNYCKNFQLQCADVPAVYNVITDGGKVTFDLNRYKELYYRLLTSPAADAGNTLMGQKP
NEREIS  : NISRDEYGIFFGMLGLDKT---MAPASFDAIDT-NNDGLLSLEEFVIAGSDF--FM-NDGDSTNKVFWGPLV

Sequence alignment of the entire sarcoplasmic calcium-binding proteins subfamily

Functional Information:

General information:

no general functional information is currently stored in the database

Biological roles:

not yet available in the data library

Disease states:

not yet available in the data library

Target molecules:

not yet available in the data library

Structural Information:

Calcium-coordination:
isoform II, Branchiostoma lanceolatum:	EF1 ; X = D19 OD1; Y = D21 OD1; Z = D23 OD2; -X = H₂O; -Y = S25 O; -Z1 = D30 OE1; -Z2 = D30 OE2 EF2 ; X = D70 OD2; Y = D72 OD1; Z = D74 OD2; -X = H₂O; -Y = V76 O; -Z1 = E81 OE1; -Z2 = E81 OE2 EF3 ; X = D115 OD1; Y = D117 OD1; Z = D119 OD1; -X = H₂O; -Y = I121 O; -Z1 = E126 OE1; -Z2 = E126 OE2 (InfoCard)
Nereis diversicolor:	EF1 ; X = D16 OD1; Y = D18 OD1; Z = D20 OD2; -X = H₂O; -Y = A22 O; -Z1 = D27 OE1; -Z2 = D27 OE2 EF2 ; X = D70 OD2; Y = D72 OD1; Z = D74 OD2; -X = H₂O; -Y = V76 O; -Z1 = E81 OE1; -Z2 = E81 OE2 EF3 ; X = D104 OD1; Y = D106 OD1; Z = D108 OD1; -X = H₂O; -Y = N110 O; -Z1 = E115 OE1; -Z2 = E115 OE2 EF4 ; X = D138 OD2; Y = D140 OD1; Z = D142 OD2; -X = H₂O; -Y = L144 O; -Z1 = E149 OE1; -Z2 = E149 OE2 (InfoCard)

Nature of the conformational changes:
not yet available in the data library

Secondary structure: (as reported in the PDB file and its accompanying reference)
isoform II, Branchiostoma lanceolatum, three calcium ions bound state:	Helices: N-terminal domain: helix 1: 4 - 18, helix 2: 28 - 42, helix 3: 48 - 69, helix 4: 79 - 91, C-terminal domain: helix 5: 103 - 114, helix 6: 124 - 132, helix 7: 141 - 148, helix 8: 176 - 181 (pdb code 2SAS: InfoCard)
Nereis diversicolor, three calcium ions bound state:	Helices: N-terminal domain: helix 1: 1 - 15, helix 2: 25 - 38, helix 3: 43 - 62, helix 4: 72 - 84, C-terminal domain: helix 5: 89 - 103, helix 6: 113 - 122, helix 7: 127 - 137, helix 8: 147 - 159 (pdb code 2SCP: InfoCard)

Additional structural information:
View a table of interhelical angles from various structures

Available structures: (follow the links from the PDB code to the retrieve the PDB files)
Calcium Loaded Structures:	2SAS: isoform II, Branchiostoma lanceolatum, full length protein, Crystal structure, 2.4 angstrom resolution, R-value = 19.9 3 Ca ions bound (InfoCard) 2SCP: Nereis diversicolor, full length protein, pH 7.8 Crystal structure, 2 angstrom resolution, R-value = 18.2 3 Ca ions bound (InfoCard)

Information about mutants:

no mutants are currently stored in the database