| Additional names and abbreviations: | No additional names are stored in the database |
|---|---|
| Isoforms: | No information about isoforms is stored in the database |
| Yeast Protein Database Entries: | No links to the YPD are stored in the database |
| Basic Chemical and Physical
Information: |
|
| Number of amino acids: | 101 (all species) View a list of all sources stored in the database |
| Molecular weight: | 11.713 kD (Homo sapiens) - 11.747 kD (Mus musculus) View a list of all sources stored in the database |
| pI: | calculated pI (Homo sapiens) = 4.55 (InfoCard) |
| Number of functional calcium binding sites: | not yet available in the data library |
| Macroscopic calcium binding constants: | not yet available in the data library |
| Other metal binding constants: | not yet available in the data library |
| Protein stability: | not yet available in the data library |
| Post-translational modifications: | not yet available in the data library |
| Basic Biological
Information: |
|
| Source organisms: | Homo sapiens,
Mus musculus
View an annotated list of all sources stored in the database |
| Tissues: | Homo sapiens: lung (InfoCard) Homo sapiens: kidney (InfoCard) Homo sapiens: heart (InfoCard) Homo sapiens: stomach (InfoCard) Homo sapiens: skeletal muscle (InfoCard) |
| Subcellular localization: | not yet available in the data library |
| Regulation: | not yet available in the data library |
| Genomic Information: |
|
| GenBank entries: | View a list of GenBank entries
stored in the database |
| Gene length: | not yet available in the data library |
| Gene structure: | Homo sapiens, expressed: GenBank code Z18950; 2 introns (InfoCard) |
| Promoter: | not yet available in the data library |
| Gene copies: | not yet available in the data library |
| Alleles: | no alleles are currently stored in the data library |
| Chromosomal localization: | Homo sapiens, expressed (GenBank code Z18950): q21 region of chromosome 1 (part of the cluster of S100 protein genes) (InfoCard) Homo sapiens, expressed (GenBank code Z18950): q21 region of chromosome 1 (part of the cluster of S100 protein genes) (InfoCard) Homo sapiens, expressed (GenBank code Z18950): q21 region of chromosome 1 (part of the cluster of S100 protein genes) (InfoCard) |
|-helixA-|--loop1------|helixB|
En**nn**nX**Y*Z**#Ix**zn**nn*n
HUMAN : MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFREC
|-helixC-|--loop2-----|helixD|
En**nn**nX*Y*ZG#Ix**zn**nn*n
HUMAN : DYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Sequence alignment of the entire S100
subfamily
General information:
Biological roles:
Disease states:
Target molecules:
| Calcium-coordination: |
|
|---|---|
| not yet available in the data library |
|
| Nature of the conformational
changes: |
|
| not yet available in the data library |
|
| Secondary structure: (as reported in the PDB file and its accompanying reference) |
|
| not yet available in the data library |
|
| Additional structural information: | |
| no additional structural information is currently
stored in the database |
|
| Available structures: (follow the links from the PDB code to the retrieve the PDB files) |
|
| no structures are currently stored in the database |
|