Home Page for S100A10

S100A10/P11

Primary information about S100A10/p11:
Basic chemical and physical information	Basic biological information	Basic genomic information	Metal ion binding constants	Interspecies sequence alignment	Information on function
Summary of structural studies	Information on the conformational change	List of available structures	Information about mutations	References about S100A10	Other web resources about S100A10
Additional information about S100A10/p11:
Information about the evolutionary relationship of S100A10/p11 to other proteins

Basic Information

Basic Chemical and Physical Information:
Additional names and abbreviations:	S100A10: calpactin light chain; CLP11; annexin II light chain (Anx2LC); 42C; p10
Isoforms:	No information about isoforms is stored in the database
Yeast Protein Database Entries:	No links to the YPD are stored in the database

Number of amino acids:	94 (Rattus norvegicus) - 96 (Mus musculus, Homo sapiens, Gallus gallus) View a list of all sources stored in the database
Molecular weight:	10.944 kD (Sus scrofa, Rattus norvegicus) - 11.159 kD (Gallus gallus) View a list of all sources stored in the database
pI:	not yet available in the data library
Number of functional calcium binding sites:	Bos taurus: 0 (InfoCard)
Macroscopic calcium binding constants:	not yet available in the data library
Other metal binding constants:	not yet available in the data library
Protein stability:	not yet available in the data library
Post-translational modifications:	not yet available in the data library

Basic Biological Information:
Source organisms:	Gallus gallus, Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus View an annotated list of all sources stored in the database
Tissues:	not yet available in the data library
Subcellular localization:	not yet available in the data library
Regulation:	not yet available in the data library

Genomic Information:
GenBank entries:	View a list of GenBank entries stored in the database
Gene length:	not yet available in the data library
Gene structure:	not yet available in the data library
Promoter:	not yet available in the data library
Gene copies:	not yet available in the data library
Alleles:	no alleles are currently stored in the data library
Chromosomal localization:	Homo sapiens, expressed (GenBank code M38591): q21 region of chromosome 1 (part of the cluster of S100 protein genes) (InfoCard) Mus musculus, expressed (GenBank code M16465): chromosome 3 (InfoCard)

Interspecies Sequence Alignment




                       |-helixA-|--loop1------|helixB| 
                       En**nn**nX**Y*Z**#Ix**zn**nn*n          

HUMAN   :     PSQMEHAMETMMFTFHKFAGDKGY---LTKEDLRVLMEKEFPGFLENQKDPL
MOUSE   :     PSQMEHAMETMMLTFHRFAGDKDH---LTKEDLRVLMEREFPGFLENQKDPL
RAT     :     PSQMEHAMETMMLTFHRFAGEKNY---LTKEDLRVLMEREFPGFLENQKDPL
PORCINE :     PSQMEHAMETMMFTFHKFAGDKGY---LTKEDLRVLMEKEFPGFLENQKDPL
CHICK   :     PSQMEHAMETLMFTFHKYAGDKNY---LSKEDLRALMEKEFPGFLENQRDPM

         |-helixC-|--loop2-----|helixD|
          En**nn**nX*Y*ZG#Ix**zn**nn*n

HUMAN   : AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
MOUSE   : AVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK
RAT     : AVDKIMKDLDQCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKK
PORCINE : AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGK
CHICK   : ALDKIMKDLDQCRDGKVGFQSFFSLVAGLTIACNDYFVVHMKQKGRK

Sequence alignment of the entire S100 subfamily

Functional Information:

General information:

no general functional information is currently stored in the database

Biological roles:

endocytosis
cell biological evidence in Rattus norvegicus: The annexin II/S100A10 complex is localized to the cortical regions of the cell, along with the peripheral early endosomes. When the cells are exposed to low calcium medium, both the annexin II/S100A10 complex and the early endosomes translocate to the cytoplasm. (InfoCard)

Disease states:

not yet available in the data library

Target molecules:

annexin II
biochemical evidence for interaction in Sus scrofa: S100A10 and annexin II copurify, and the complex cn be reconstituted by mixing purifed S100A10 and annexin II (InfoCard)

Structural Information:

Calcium-coordination:
not yet available in the data library

Nature of the conformational changes:
not yet available in the data library

Secondary structure: (as reported in the PDB file and its accompanying reference)
not yet available in the data library

Additional structural information:
View a table of interhelical angles from various structures

Available structures: (follow the links from the PDB code to the retrieve the PDB files)
Apo Structures:	1A4P: Homo sapiens, homodimer, pH 7.5 Crystal structure, 2.25 angstrom resolution, R-value = 24.6, R-free = 30.3 (InfoCard)
Target Peptide Bound Structures:	1BT6: Homo sapiens, homodimer complexed to annexin peptide, pH 7.5 Crystal structure, 2.4 angstrom resolution, R-value = 23.3, R-free = 22.8 (InfoCard)

Information about mutants:

no mutants are currently stored in the database