Home Page for Hippocalcin

Hippocalcin

Primary information about hippocalcin:
Basic chemical and physical information	Basic biological information	Basic genomic information	Metal ion binding constants	Interspecies sequence alignment	Information on function
Summary of structural studies	Information on the conformational change	List of available structures	Information about mutations	References about hippocalcin	Other web resources about hippocalcin

Basic Information

Basic Chemical and Physical Information:
Additional names and abbreviations:	hippocalcin: p23K
Isoforms:	No information about isoforms is stored in the database
Yeast Protein Database Entries:	No links to the YPD are stored in the database

Number of amino acids:	192 (all species) View a list of all sources stored in the database
Molecular weight:	22.296 kD (Rattus norvegicus) - 22.322 kD (Homo sapiens) View a list of all sources stored in the database
pI:	calculated pI (Homo sapiens) = 4.7 (InfoCard)
Number of functional calcium binding sites:	Homo sapiens: 3 (InfoCard)
Macroscopic calcium binding constants:	not yet available in the data library
Other metal binding constants:	not yet available in the data library
Protein stability:	not yet available in the data library
Post-translational modifications:	Homo sapiens: myristoylation on N-terminus (InfoCard) Rattus norvegicus: myristoylation on N-terminus (InfoCard)

Basic Biological Information:
Source organisms:	Homo sapiens, Rattus norvegicus View an annotated list of all sources stored in the database
Tissues:	Rattus norvegicus: hippocampal pyramidal cells in the brain (InfoCard) Rattus norvegicus: dentate granule cells in the brain (InfoCard) Rattus norvegicus: cortical pyramidal cells in the brain (InfoCard) Rattus norvegicus: cerebellar Purkije cells in the brain (InfoCard)
Subcellular localization:	not yet available in the data library
Regulation:	not yet available in the data library

Genomic Information:
GenBank entries:	View a list of GenBank entries stored in the database
Gene length:	Rattus norvegicus, expressed (GenBank code D12573): 13 kb (InfoCard) Homo sapiens, expressed (GenBank code D16593): 13 kb (InfoCard)
Gene structure:	Rattus norvegicus, expressed: GenBank code D12573; intron 1 precedes residue 125, intron 2 precedes residue 161 (InfoCard) Homo sapiens, expressed: GenBank code D16593; intron 1 precedes residue 125, intron 2 precedes residue 161 (InfoCard)
Promoter:	not yet available in the data library
Gene copies:	not yet available in the data library
Alleles:	no alleles are currently stored in the data library
Chromosomal localization:	Homo sapiens, expressed (GenBank code D16593): chromosome 1 (InfoCard)

Interspecies Sequence Alignment


 
                                  |-helixA-|--loop1----|helixB|
                                   En**nn**nX*Y*ZG#Ix**zn**nn*n

HUMAN   : GKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYAN
RAT     : GKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYAN


                  |-helixC-|--loop2----|helixD|
                   En**nn**nX*Y*ZG#Ix**zn**nn*n

HUMAN   : FFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRL
RAT     : FFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRL


           |-helixE-|--loop3----|helixF|
            En**nn**nX*Y*ZG#Ix**zn**nn*n 

HUMAN   : EQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEK
RAT     : EQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEK


         |-helixG-|--loop4----|helixH|
          En**nn**nX*Y*ZG#Ix**zn**nn*n

HUMAN   : RTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
RAT     : RTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Sequence alignment for the entire neuronal calcium sensors subfamily

Functional Information:

General information:

no general functional information is currently stored in the database

Biological roles:

not yet available in the data library

Disease states:

not yet available in the data library

Target molecules:

not yet available in the data library

Structural Information:

Calcium-coordination:
not yet available in the data library

Nature of the conformational changes:
not yet available in the data library

Secondary structure: (as reported in the PDB file and its accompanying reference)
not yet available in the data library

Additional structural information:
no additional structural information is currently stored in the database

Available structures: (follow the links from the PDB code to the retrieve the PDB files)
no structures are currently stored in the database

Information about mutants:

no mutants are currently stored in the database