| Additional names and abbreviations: | myosin essential light chain: myosin alkaline light chain; myosin catalytic light chain; myosin enzymatic light chain |
|---|---|
| Isoforms: | L23 isoform cardiac muscle isoform embryonic muscle isoform insect larval and adult isoform insect pupal isoform lower animal isoform non-muscle isoform skeletal muscle isoform skeletal muscle isoform 2 slow-twitch muscle isoform slow-twitch muscle isoform A smooth muscle isoform |
| Yeast Protein Database Entries: | MLC1 |
| Basic Chemical and Physical
Information: |
|
| Number of amino acids: | L23 isoform: 185 (all species) cardiac muscle isoform: 196 (all species) embryonic muscle isoform: 192 (Rattus norvegicus, Mus musculus) - 196 (Homo sapiens) insect larval and adult isoform: 155 (all species) insect pupal isoform: 154 (Drosophila virilis) - 155 (Drosophila pseudoobscura, Drosophila melanogaster, Drosophila simulans) lower animal isoform: 149 (Branchiostoma floridae ) - 159 (Todarodes pacificus) non-muscle isoform: 141 (Mus musculus) - 150 (Gallus gallus, Homo sapiens) skeletal muscle isoform: 187 (Mus musculus) - 193 (Homo sapiens) skeletal muscle isoform 2: 149 (all species) slow-twitch muscle isoform: 194 (Homo sapiens) - 199 (Rattus norvegicus) slow-twitch muscle isoform A: 208 (all species) smooth muscle isoform: 150 (all species) View a list of all sources stored in the database |
| Molecular weight: | L23 isoform: 20.619 kD (all species) cardiac muscle isoform: 21.865 kD (all species) embryonic muscle isoform: 21.028 kD (Mus musculus) - 21.433 kD (Homo sapiens) insect larval and adult isoform: 17.542 kD (Drosophila simulans) - 17.617 kD (Drosophila virilis) insect pupal isoform: 17.427 kD (Drosophila virilis) - 17.561 kD (Drosophila melanogaster) lower animal isoform: 16.141 kD (Branchiostoma floridae ) - 18.059 kD (Todarodes pacificus) non-muscle isoform: 15.731 kD (Mus musculus) - 16.852 kD (Gallus gallus) skeletal muscle isoform: 20.463 kD (Mus musculus) - 21.014 kD (Homo sapiens) skeletal muscle isoform 2: 16.468 kD (Mus musculus) - 16.579 kD (Gallus gallus) slow-twitch muscle isoform: 21.801 kD (Homo sapiens) - 22.025 kD (Rattus norvegicus) slow-twitch muscle isoform A: 22.764 kD (all species) smooth muscle isoform: 16.83 kD (Homo sapiens) - 16.856 kD (Gallus gallus) View a list of all sources stored in the database |
| pI: | not yet available in the data library |
| Number of functional calcium binding sites: | lower animal isoform, Aequipecten irradians: 1 (InfoCard) |
| Macroscopic calcium binding constants: | not yet available in the data library |
| Other metal binding constants: | not yet available in the data library |
| Protein stability: | not yet available in the data library |
| Post-translational modifications: | not yet available in the data library |
| Basic Biological
Information: |
|
| Source organisms: | L23 isoform: Gallus gallus
cardiac muscle isoform: Gallus gallus embryonic muscle isoform: Homo sapiens, Mus musculus, Rattus norvegicus insect larval and adult isoform: Drosophila pseudoobscura, Drosophila simulans, Drosophila melanogaster, Drosophila virilis insect pupal isoform: Drosophila pseudoobscura, Drosophila simulans, Drosophila melanogaster, Drosophila virilis lower animal isoform: Branchiostoma floridae , Caenorhabditis elegans, Dictyostelium discoideum, Halocynthia roretzi, Patinopecten yessoensis, Aequipecten irradians, Todarodes pacificus non-muscle isoform: Gallus gallus, Drosophila melanogaster, Homo sapiens, Mus musculus skeletal muscle isoform: Gallus gallus, Homo sapiens, Mus musculus, Oryctolagus cuniculus, Rattus norvegicus skeletal muscle isoform 2: Gallus gallus, Homo sapiens, Mus musculus, Oryctolagus cuniculus, Rattus norvegicus slow-twitch muscle isoform: Homo sapiens, Rattus norvegicus slow-twitch muscle isoform A: Homo sapiens smooth muscle isoform: Gallus gallus, Homo sapiens, Rattus norvegicus View an annotated list of all sources stored in the database |
| Tissues: | not yet available in the data library |
| Subcellular localization: | not yet available in the data library |
| Regulation: | not yet available in the data library |
| Genomic Information: |
|
| GenBank entries: | not yet available in the data library |
| Gene length: | not yet available in the data library |
| Gene structure: | not yet available in the data library |
| Promoter: | not yet available in the data library |
| Gene copies: | not yet available in the data library |
| Alleles: | no alleles are currently stored in the data library |
| Chromosomal localization: | not yet available in the data library |
|-helixI-|--loop1----|helixII|
En**nn**nX-*Y*Z-G#Ix**zn**nn*n
Lower animal isoform:
SCALLOP :1 PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRC 39
|helixIII|----loop2----|helixIV|
En**nn**n--X*Y*ZG#Ix**zn**nn*n
Lower animal isoform:
SCALLOP :40 LGINPRN-EDVFAVGGT--HKMGEKSLPFEEFLPAYEGL 75
|-helixI-|--loop1----|helixII|
En**nn**nX-*Y*Z-G#Ix**zn**nn*n
Lower animal isoform:
SCALLOP :76 MDCEQGTFADYMEAFKTFD-REGQ-GFISGAELRHVLTA 112
|helixIII|----loop2----|helixIV|
En**nn**n--X*Y*ZG#Ix**zn**nn*n
Lower animal isoform:
SCALLOP :113 LGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK 156
Sequence alignment for the entire calmodulin
subfamily
General information:
Biological roles:
Disease states:
Target molecules:
| Calcium-coordination: |
|
|---|---|
| not yet available in the data library |
|
| Nature of the conformational
changes: |
|
| Conformational change between one calcium ion bound and one calcium ion and target peptide bound states of lower animal isoform: |
There is no structure of ELC not bound to the heavy chain. However, in the structure of the myosin light chains complexed to the heavy chain, ELC-N is in the closed conformation and ELC-C is in the semi-open conformation. ELC-N can be used as a model for closed conformation ELC-C, allowing a determination of the conformational changes expected to be induced by heavy chain binding if ELC-C adopts a closed conformation in tyhe absence of the heavy chain. The differences between these conformations are confined to the reorganization of existing secondary structural elements. The closed conformation is very similar to that seen in apo calmodulin. The semi-open conformation is a distinct conformation, and not merely midway between the closed and open conformation. In this conformation: Helices II and III are drawn together at the bottoms; Helices I and II are pried apart; Helices III and IV "scissor" apart, with a pivot point in the top half of the interface. (InfoCard) |
| Secondary structure: (as reported in the PDB file and its accompanying reference) |
|
| not yet available in the data library |
|
| Additional structural information: | |
|
|
| Available structures: (follow the links from the PDB code to the retrieve the PDB files) |
|
| Calcium Loaded Structures: |
1WDC: lower animal isoform, Aequipecten irradians, regulatory domain, pH 7 Crystal structure, 2 angstrom resolution, R-value = 19.85, R-free = 27.97 1 Ca ion bound , bound to 1 equivalentsof the following portion of myosin II heavy chain: residues 774 through 837, a proteolytically stable fragment when complexed with light chains, 1 equivalentsof the following portion of myosin II heavy chain: residues 774 through 837, a proteolytically stable fragment when complexed with light chains (InfoCard) 1SCM: lower animal isoform, Aequipecten irradians, regulatory domain, pH 7 Crystal structure, 2.8 angstrom resolution, R-value = 20.1 1 Ca ion bound , bound to 1 equivalentsof the following portion of myosin II heavy chain: residues 774 through 837, a proteolytically stable fragment when complexed with light chains, 1 equivalentsof the following portion of myosin II heavy chain: residues 774 through 837, a proteolytically stable fragment when complexed with light chains (InfoCard) |