Home Page for Calcium Dependent Protein Kinase

Calcium Dependent Protein Kinase

Primary information about calcium-dependent protein kinase:
Basic chemical and physical information	Basic biological information	Basic genomic information	Metal ion binding constants	Interspecies sequence alignment	Information on function
Summary of structural studies	Information on the conformational change	List of available structures	Information about mutations	References about calcium-dependent protein kinase	Other web resources about calcium-dependent protein kinase
Additional information about calcium-dependent protein kinase:
Information about the evolutionary relationship of calcium-dependent protein kinase to other proteins

Basic Information

Basic Chemical and Physical Information:
Additional names and abbreviations:	calcium-dependent protein kinase: calmodulin-domain protein kinase
Isoforms:	isoform 1 isoform 11 isoform 3
Yeast Protein Database Entries:	No links to the YPD are stored in the database

Number of amino acids:	isoform 1: 508 (Glycine max) - 610 (Arabidopsis thaliana) isoform 11: 542 (all species) isoform 3: 513 (Zea mays) - 533 (Oryza sativa) View a list of all sources stored in the database
Molecular weight:	isoform 1: 57.169 kD (Glycine max) - 68.253 kD (Arabidopsis thaliana) isoform 11: 61.166 kD (all species) isoform 3: 58.081 kD (Zea mays) - 59.522 kD (Oryza sativa) View a list of all sources stored in the database
pI:	not yet available in the data library
Number of functional calcium binding sites:	not yet available in the data library
Macroscopic calcium binding constants:	not yet available in the data library
Other metal binding constants:	not yet available in the data library
Protein stability:	not yet available in the data library
Post-translational modifications:	not yet available in the data library

Basic Biological Information:
Source organisms:	isoform 1: Arabidopsis thaliana, Daucus carota, Oryza sativa, Glycine max isoform 11: Oryza sativa isoform 3: Zea mays, Oryza sativa View an annotated list of all sources stored in the database
Tissues:	not yet available in the data library
Subcellular localization:	not yet available in the data library
Regulation:	not yet available in the data library

Genomic Information:
GenBank entries:	not yet available in the data library
Gene length:	not yet available in the data library
Gene structure:	not yet available in the data library
Promoter:	not yet available in the data library
Gene copies:	not yet available in the data library
Alleles:	no alleles are currently stored in the data library
Chromosomal localization:	not yet available in the data library

Interspecies Sequence Alignment



                         |-helixI-|--loop1----|helixII|
                          En**nn**nX*Y*ZG#Ix**zn**nn*n

ARABID  :    ...AESLSEEEIAGLKEMFNMIDADKSGQITFEELKAGLKRVGANLKES
SOY     :    ...AERLSEEEIGGLKELFKMIDTDNSGTITFDELKDGLKRVGSELMES


         |helixIII|--loop2----|helixIV|      |-helixV-|-loop3-----|helixVI|
          En**nn**nX*Y*ZG#Ix**zn**nn*n        En**nn**nX*Y*ZG#Ix**zn**nn*n

ARABID  : EILDLMQAADVDNSGTIDYKEFIAATLHLNKIEREDHLFAAFTYFDKDGSGYITPDELQQACEE
SOY     : EIKDLMDAADIDKSGTIDYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKD


             |helixVII|--loop4----|helixVIII|
              En**nn**nX*Y*ZG#Ix**zn**nn*n

ARABID  : FGVEDVRIEELMRDVDQDNDGRIDYNEFVAMMQKGSITGGPVKMGLEKSFSIALKL
SOY     : FGLDDIHIDDMIKEIDQDNDGQIDYGEFAAMMRKGNGGIGRRTMRKTLNLRDALGLVDNGSNQVIEGYFK

Sequence alignment for the entire calmodulin subfamily

Functional Information:

General information:

isoform 1, in all sources of a given proteinThe calmodulin-like domain is covalently attached to its "target" kinase (InfoCard)
isoform 1, in all sources of a given proteinThe kinase domain is very similar to other calcium/calmodulin-dependent protein kinases (InfoCard)

Biological roles:

not yet available in the data library

Disease states:

not yet available in the data library

Target molecules:

isoform 1: nodulin 26
cell biological evidence for interaction in Glycine max: Nodulin 26 is phosphorylated in situ by CDPK, as determined by studies with radioactively labeled phosphate (InfoCard)

Structural Information:

Calcium-coordination:
not yet available in the data library

Nature of the conformational changes:
not yet available in the data library

Secondary structure: (as reported in the PDB file and its accompanying reference)
not yet available in the data library

Additional structural information:
no additional structural information is currently stored in the database

Available structures: (follow the links from the PDB code to the retrieve the PDB files)
no structures are currently stored in the database

Information about mutants:

no mutants are currently stored in the database