Home Page for Calmodulin Like Protein

Calmodulin Like Protein

Primary information about calmodulin-like protein:
Basic chemical and physical information	Basic biological information	Basic genomic information	Metal ion binding constants	Interspecies sequence alignment	Information on function
Summary of structural studies	Information on the conformational change	List of available structures	Information about mutations	References about calmodulin-like protein	Other web resources about calmodulin-like protein
Additional information about calmodulin-like protein:
Information about the evolutionary relationship of calmodulin-like protein to other proteins

Basic Information

Basic Chemical and Physical Information:
Additional names and abbreviations:	No additional names are stored in the database
Isoforms:	No information about isoforms is stored in the database
Yeast Protein Database Entries:	No links to the YPD are stored in the database

Number of amino acids:	148 (Homo sapiens) - 161 (Caenorhabditis elegans) View a list of all sources stored in the database
Molecular weight:	16.759 kD (Homo sapiens) - 18.707 kD (Caenorhabditis elegans) View a list of all sources stored in the database
pI:	calculated pI (Homo sapiens) = 4.1 (InfoCard)
Number of functional calcium binding sites:	Homo sapiens: 4 (InfoCard)
Macroscopic calcium binding constants:	Homo sapiens, low salt: K₁ = 3.80 x 10⁵ +/- 4.00 x 10⁴; K₂ = 1.90 x 10⁵ +/- 2.00 x 10⁴; K₃ = 4.90 x 10⁴ +/- 1.00 x 10⁴; K₄ = 1.20 x 10⁴ +/- 3.00 x 10³ (measured by: flow dialysis pH: 7.5 temperature: 25 degrees Celsius buffer: 0.03 M HEPES, 0.002 M MgCl2, 0.0075 M beta-mercaptoethanol, 0.03 M imidazole ) (InfoCard)
Other metal binding constants:	not yet available in the data library
Protein stability:	not yet available in the data library
Post-translational modifications:	not yet available in the data library

Basic Biological Information:
Source organisms:	Caenorhabditis elegans, Homo sapiens View an annotated list of all sources stored in the database
Tissues:	Homo sapiens: normal epithelial cells of the breast (InfoCard) Homo sapiens: prostrate (InfoCard) Homo sapiens: cervix (InfoCard) Homo sapiens: skin (InfoCard)
Subcellular localization:	not yet available in the data library
Regulation:	not yet available in the data library

Genomic Information:
GenBank entries:	not yet available in the data library
Gene length:	not yet available in the data library
Gene structure:	not yet available in the data library
Promoter:	not yet available in the data library
Gene copies:	not yet available in the data library
Alleles:	no alleles are currently stored in the data library
Chromosomal localization:	not yet available in the data library

Interspecies Sequence Alignment



                                     |-helixI-|--loop1----|helixII|
                                      En**nn**nX*Y*ZG#Ix**zn**nn*n

HUMAN   :                   ADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEA
CELEG   :     MAIPSNLMQFSEDIIKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQ


         |helixIII|--loop2----|helixIV|        |-helixV-|-loop3-----|helixVI|
          En**nn**nX*Y*ZG#Ix**zn**nn*n         En**nn**nX*Y*ZG#Ix**zn**nn*n

HUMAN   : ELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTR
CELEG   : EILEMINEVDIDGNGQIEFPEFCVMMKRMMKETD-SEMIREAFRVFDKDGNGVITAQEFRYFMVH


                 |helixVII|--loop4----|helixVIII|
                  En**nn**nX*Y*ZG#Ix**zn**nn*n

HUMAN   : LGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
CELEG   : MGMQFSEEEVDEMIKEVDVDGDGEIDYEEFVKMMSNQ

Sequence alignment for the entire calmodulin subfamily

Functional Information:

General information:

in Homo sapiensOnly 23 amino acids differ between calmodulin and calmodulin-like protein (InfoCard)
in Homo sapiensCalmodulin-like protein may compete with calmodulin by binding to the same cellular targets with different affinities (InfoCard)

Biological roles:

not yet available in the data library

Disease states:

cancer
genetic evidence : The gene for calmodulin-like protein is down-regulated in transformed human mammary epithelial cells (InfoCard)

Target molecules:

not yet available in the data library

Structural Information:

Calcium-coordination:
not yet available in the data library

Nature of the conformational changes:
not yet available in the data library

Secondary structure: (as reported in the PDB file and its accompanying reference)
not yet available in the data library

Additional structural information:
no additional structural information is currently stored in the database

Available structures: (follow the links from the PDB code to the retrieve the PDB files)
no structures are currently stored in the database

Information about mutants:

no mutants are currently stored in the database