CaBP Data Library General Information

S100A12/Calgranulin C

Primary information about S100A12/calgranulin C:
Basic chemical and physical information
 Basic biological information
 Basic genomic information
 Metal ion binding constants
 Interspecies sequence alignment
 Information on function
Summary of structural studies
 Information on the conformational change List of available structures Information about mutations
 References about S100A12 Other web resources about S100A12

Basic Information

Additional names and abbreviations: S100A12: p6; CAAF1; CGRP
Isoforms: No information about isoforms is stored in the database
Yeast Protein Database Entries: No links to the YPD are stored in the database

Basic Chemical and Physical Information:
Number of amino acids: 91 (all species)
View a list of all sources stored in the database
Molecular weight: 10.444 kD (Homo sapiens) - 10.614 kD (Sus scrofa)
View a list of all sources stored in the database
pI: not yet available in the data library
Number of functional calcium binding sites: Sus scrofa: 2 (InfoCard)
Macroscopic calcium binding constants: Sus scrofa, low salt: K1 = 1.90 x 104 +/- 4.00 x 103 (measured by: flow dialysis pH: 7.4 temperature: 20 degrees Celsius buffer: 0.025 M Tris-HCl ) (InfoCard)
Sus scrofa, low salt: K1 = 2.7 x 107 +/- 3 x 106; K2 = 6.50 x 104 +/- 1.20 x 104 (measured by: flow dialysis pH: 7.4 temperature: 20 degrees Celsius buffer: 0.025 M Tris-HCl, 1e-04 M ZnCl2 ) (InfoCard)
Other metal binding constants: not yet available in the data library
Protein stability: not yet available in the data library
Post-translational modifications: not yet available in the data library

Basic Biological Information:
Source organisms: Bos taurus, Homo sapiens, Sus scrofa
View an annotated list of all sources stored in the database
Tissues: Homo sapiens: granulocytes (InfoCard)
Subcellular localization: Homo sapiens, granulocytes: cytoplasm (InfoCard)
Regulation: not yet available in the data library

Genomic Information:
GenBank entries: not yet available in the data library
Gene length: not yet available in the data library
Gene structure: not yet available in the data library
Promoter: not yet available in the data library
Gene copies: not yet available in the data library
Alleles: no alleles are currently stored in the data library
Chromosomal localization: not yet available in the data library

Interspecies Sequence Alignment


 
                  |-helixA-|--loop1------|helixB| 
                   En**nn**nX**Y*Z**#Ix**zn**nn*n 

PORCINE :  TKLEDHLEGIINIFHQYSVRLGHYDTLIKRELKQLITKELPNTLKN


              |-helixC-|--loop2-----|helixD|
               En**nn**nX*Y*ZG#Ix**zn**nn*n
 
PORCINE : TKDQGTIDKIFQNLDANQDEQVSFKEFVVLVTDVLITAHDNIHKE 91
Sequence alignment for the entire S100 subfamily

Functional Information:

General information:

Biological roles:

Disease states:

Target molecules:

Structural Information:

Calcium-coordination:
not yet available in the data library

Nature of the conformational changes:
not yet available in the data library

Secondary structure:
(as reported in the PDB file and its accompanying reference)
not yet available in the data library

Additional structural information:
no additional structural information is currently stored in the database

Available structures:
(follow the links from the PDB code to the retrieve the PDB files)
no structures are currently stored in the database

Information about mutants: