| Primary information about myosin regulatory light chain: |
|||||
|---|---|---|---|---|---|
| Basic chemical and physical information |
Basic biological information |
Basic genomic information |
Metal ion binding constants |
Interspecies sequence alignment |
Information on function |
| Summary of structural studies |
Information on the conformational change | List of available structures | Information about mutations |
References about myosin regulatory light chain | Other web resources
about myosin regulatory light chain |
| Additional information about myosin regulatory light
chain: |
|||||
| Information about the
evolutionary relationships of the myosin regulatory light chain and other
proteins |
|||||
| Additional names and abbreviations: | myosin regulatory light chain: myosin DTNB light chain; myosin light chain-2 |
|---|---|
| Isoforms: | RLC 1 RLC 2 RLC 2 major smooth muscle isoform RLC 2 minor smooth muscle isoform RLC 2 non-sarcomeric isoform RLC 2 skeletal muscle isoform type 1 RLC 2 skeletal muscle isoform type 2 RLC 2 ventricular isoform type RLC 2A cardiac muscle isoform RLC 2A smooth muscle isoform RLC 2B cardiac muscle isoform RLC 2B smooth muscle isoform RLC nonmuscle isoform lower animal smooth muscle isoform lower animal striated muscle isoform superfast RLC 2 |
| Yeast Protein Database Entries: | No links to the YPD are stored in the database |
| Basic Chemical and Physical
Information: |
|
| Number of amino acids: | RLC 1: 147 (Physarum polycephalum) - 221 (Drosophila melanogaster) RLC 2: 170 (all species) RLC 2 major smooth muscle isoform: 171 (all species) RLC 2 minor smooth muscle isoform: 170 (Rattus norvegicus) - 171 (Gallus gallus) RLC 2 non-sarcomeric isoform: 170 (all species) RLC 2 skeletal muscle isoform type 1: 164 (Homo sapiens) - 169 (Oryctolagus cuniculus) RLC 2 skeletal muscle isoform type 2: 166 (Gallus gallus) - 169 (Oryctolagus cuniculus) RLC 2 ventricular isoform type: 164 (Homo sapiens) - 165 (Rattus norvegicus, Mus musculus) RLC 2A cardiac muscle isoform: 164 (all species) RLC 2A smooth muscle isoform: 161 (Patinopecten yessoensis) - 171 (Rattus norvegicus, Sus scrofa, Homo sapiens) RLC 2B cardiac muscle isoform: 163 (all species) RLC 2B smooth muscle isoform: 156 (Patinopecten yessoensis) - 171 (Rattus norvegicus) RLC nonmuscle isoform: 174 (all species) lower animal smooth muscle isoform: 153 (all species) lower animal striated muscle isoform: 156 (Patinopecten yessoensis, Aequipecten irradians, Chlamys nipponensis akazar) - 195 (Lumbricus terrestris) superfast RLC 2: 173 (all species) View a list of all sources stored in the database |
| Molecular weight: | RLC 1: 16.081 kD (Physarum polycephalum) - 23.583 kD (Drosophila melanogaster) RLC 2: 18.603 kD (all species) RLC 2 major smooth muscle isoform: 19.714 kD (all species) RLC 2 minor smooth muscle isoform: 19.589 kD (Rattus norvegicus) - 19.78 kD (Gallus gallus) RLC 2 non-sarcomeric isoform: 19.663 kD (all species) RLC 2 skeletal muscle isoform type 1: 18.601 kD (Homo sapiens) - 18.897 kD (Oryctolagus cuniculus) RLC 2 skeletal muscle isoform type 2: 18.637 kD (Gallus gallus) - 18.895 kD (Oryctolagus cuniculus) RLC 2 ventricular isoform type: 18.601 kD (Homo sapiens) - 18.751 kD (Mus musculus) RLC 2A cardiac muscle isoform: 18.574 kD (all species) RLC 2A smooth muscle isoform: 18.384 kD (Patinopecten yessoensis) - 19.764 kD (Rattus norvegicus) RLC 2B cardiac muscle isoform: 18.587 kD (all species) RLC 2B smooth muscle isoform: 17.621 kD (Patinopecten yessoensis) - 19.707 kD (Rattus norvegicus) RLC nonmuscle isoform: 19.954 kD (all species) lower animal smooth muscle isoform: 17.272 kD (all species) lower animal striated muscle isoform: 17.499 kD (Chlamys nipponensis akazar) - 21.945 kD (Lumbricus terrestris) superfast RLC 2: 19.403 kD (Felis silvestris catus) - 19.534 kD (Homo sapiens) View a list of all sources stored in the database |
| pI: | not yet available in the data library |
| Number of functional calcium binding sites: | not yet available in the data library |
| Macroscopic calcium binding constants: | not yet available in the data library |
| Other metal binding constants: | not yet available in the data library |
| Protein stability: | not yet available in the data library |
| Post-translational modifications: | not yet available in the data library |
| Basic Biological
Information: |
|
| Source organisms: | RLC 1: Caenorhabditis elegans,
Dictyostelium discoideum,
Drosophila melanogaster,
Patinopecten sp.,
Physarum polycephalum,
Spisula sachalinensis,
Todarodes pacificus
RLC 2: Caenorhabditis elegans RLC 2 major smooth muscle isoform: Gallus gallus RLC 2 minor smooth muscle isoform: Gallus gallus, Rattus norvegicus RLC 2 non-sarcomeric isoform: Homo sapiens RLC 2 skeletal muscle isoform type 1: Homo sapiens, Mus musculus, Oryctolagus cuniculus, Rattus norvegicus RLC 2 skeletal muscle isoform type 2: Gallus gallus, Mus musculus, Oryctolagus cuniculus, Rattus norvegicus RLC 2 ventricular isoform type: Homo sapiens, Mus musculus, Rattus norvegicus RLC 2A cardiac muscle isoform: Gallus gallus RLC 2A smooth muscle isoform: Homo sapiens, Patinopecten yessoensis, Sus scrofa, Rattus norvegicus RLC 2B cardiac muscle isoform: Gallus gallus RLC 2B smooth muscle isoform: Patinopecten yessoensis, Rattus norvegicus RLC nonmuscle isoform: Drosophila melanogaster lower animal smooth muscle isoform: Halocynthia roretzi lower animal striated muscle isoform: Chlamys nipponensis akazar, Lumbricus terrestris, Patinopecten yessoensis, Aequipecten irradians superfast RLC 2: Felis silvestris catus, Homo sapiens View an annotated list of all sources stored in the database |
| Tissues: | not yet available in the data library |
| Subcellular localization: | not yet available in the data library |
| Regulation: | not yet available in the data library |
| Genomic Information: |
|
| GenBank entries: | not yet available in the data library |
| Gene length: | not yet available in the data library |
| Gene structure: | not yet available in the data library |
| Promoter: | not yet available in the data library |
| Gene copies: | not yet available in the data library |
| Alleles: | no alleles are currently stored in the data library |
| Chromosomal localization: | not yet available in the data library |
|-helixI-|--loop1----|helixII|
En**nn**nX-*Y*Z-G#Ix**zn**nn*n
Lower animal striated muscle isoform:
SCALLOP :1 ADKAASGVLTKLPQKQIQEMKEAFSMID-VDRD-GFVSKEDIKAISEQ 46
|helixIII|----loop2----|helixIV|
En**nn**n--X*Y*ZG#Ix**zn**nn*n
Lower animal striated muscle isoform:
SCALLOP :47 LGRAPDDKELTAML-----KEAPGPLNFTMFLSIFSDK 79
|-helixI-|--loop1----|helixII|
En**nn**nX-*Y*Z-G#Ix**zn**nn*n
Lower animal striated muscle isoform:
SCALLOP :80 LSGTDSEETIRNAFAMFD-EQET-KKLNIEYIKDLLEN 115
|helixIII|----loop2----|helixIV|
En**nn**n--X*Y*ZG#Ix**zn**nn*n
Lower animal striated muscle isoform:
SCALLOP :116 MGDNFNKDEMRMTFKEA--PVE-GGKFDYVKFTAMIKGSGEEEA 156
Sequence alignment of the entire calmodulin
subfamily
General information:
Biological roles:
Disease states:
Target molecules:
| Calcium-coordination: |
|
|---|---|
| not yet available in the data library |
|
| Nature of the conformational
changes: |
|
| not yet available in the data library |
|
| Secondary structure: (as reported in the PDB file and its accompanying reference) |
|
| not yet available in the data library |
|
| Additional structural information: | |
|
|
| Available structures: (follow the links from the PDB code to the retrieve the PDB files) |
|
| Other Metal Bound Structures: |
1WDC: lower animal striated muscle isoform, Aequipecten irradians, regulatory domain, pH 7 Crystal structure, 2 angstrom resolution, R-value = 19.85, R-free = 27.97 1 Mg ion bound , bound to 1 equivalentsof the following portion of myosin II heavy chain: residues 774 through 837, a proteolytically stable fragment when complexed with light chains, 1 equivalentsof the following portion of myosin II heavy chain: residues 774 through 837, a proteolytically stable fragment when complexed with light chains (InfoCard) 1SCM: lower animal striated muscle isoform, Aequipecten irradians, regulatory domain, pH 7 Crystal structure, 2.8 angstrom resolution, R-value = 20.1 1 Mg ion bound , bound to 1 equivalentsof the following portion of myosin II heavy chain: residues 774 through 837, a proteolytically stable fragment when complexed with light chains, 1 equivalentsof the following portion of myosin II heavy chain: residues 774 through 837, a proteolytically stable fragment when complexed with light chains (InfoCard) |