Home Page for Caltractin

Caltractin

Primary information about caltractin:
Basic chemical and physical information	Basic biological information	Basic genomic information	Metal ion binding constants	Interspecies sequence alignment	Information on function
Summary of structural studies	Information on the conformational change	List of available structures	Information about mutations	References about caltractin	Other web resources about caltractin
Additional information about caltractin:
Information about the evolutionary relationship of caltractin to other proteins

Basic Information

Basic Chemical and Physical Information:
Additional names and abbreviations:	caltractin: cdc31p (in saccaromyces cerevisiae); centrin
Isoforms:	isoform 1 isoform 2 (isoform in higher animals) isoform 2b (isoform in Paramecium, unclear if it is associated with one of the higher animal isoforms) isoform 2c (isoform in Paramecium, unclear if it is associated with one of the higher animal isoforms) isoform 3 (isoform in higher animals most similar to yeast CDC31)
Yeast Protein Database Entries:	CDC31

Number of amino acids:	isoform 1: 167 (Atriplex nummularia) - 181 (Paramecium tetraurelia) isoform 2: 172 (Homo sapiens) - 173 (Saccharomyces cerevisiae) isoform 2b: 188 (all species) isoform 2c: 183 (all species) View a list of all sources stored in the database
Molecular weight:	isoform 1: 19.244 kD (Atriplex nummularia) - 20.3 kD (Paramecium tetraurelia) isoform 2: 19.57 kD (Homo sapiens) - 19.783 kD (Saccharomyces cerevisiae) isoform 2b: 20.469 kD (all species) isoform 2c: 20.57 kD (all species) View a list of all sources stored in the database
pI:	not yet available in the data library
Number of functional calcium binding sites:	isoform 1, Chlamydomonas reinhardtii: 4 (InfoCard)
Macroscopic calcium binding constants:	isoform 1, Chlamydomonas reinhardtii, medium salt: K₁ = 8.30 x 10⁵; K₂ = 8.30 x 10⁵; K₃ = 6.25 x 10³; K₄ = 6.25 x 10³ (measured by: flow dialysis pH: 7.5 temperature: 25 degrees Celsius salt: 75 mM KCl buffer: 0.05 M HEPES ) (InfoCard) isoform 1, Chlamydomonas reinhardtii, medium salt: K₁ = 2.80 x 10⁵; K₂ = 2.80 x 10⁵; K₃ = 1.75 x 10³; K₄ = 1.75 x 10³ (measured by: flow dialysis pH: 7.5 temperature: 25 degrees Celsius salt: 75 mM KCl buffer: 0.05 M HEPES, 0.005 M MgCl2 ) (InfoCard)
Other metal binding constants:	not yet available in the data library
Protein stability:	not yet available in the data library
Post-translational modifications:	isoform 1, Tetraselmis striata: phosphorylation (InfoCard)

Basic Biological Information:
Source organisms:	isoform 1: Atriplex nummularia, Chlamydomonas reinhardtii, Dunaliella salina, Giardia intestinalis, Homo sapiens, Mus musculus, Naegleria gruberi, Paramecium tetraurelia, Scherffelia dubia, Tetraselmis striata isoform 2: Homo sapiens, Saccharomyces cerevisiae isoform 2b: Paramecium tetraurelia isoform 2c: Paramecium tetraurelia isoform 3: Homo sapiens View an annotated list of all sources stored in the database
Tissues:	not yet available in the data library
Subcellular localization:	isoform 1, Chlamydomonas reinhardtii: basal bodies (microtubule organizing center) (InfoCard) isoform 1, Homo sapiens: centrosome (microtubule organizing center) (InfoCard) isoform 3, Homo sapiens: centrosome (microtubule organizing center) (InfoCard)
Regulation:	not yet available in the data library

Genomic Information:
GenBank entries:	View a list of GenBank entries stored in the database
Gene length:	not yet available in the data library
Gene structure:	isoform 1, Chlamydomonas reinhardtii, expressed: GenBank code X57973; intron 1 precedes residue 36, intron 2 precedes residue 48, intron 3 precedes residue 65, intron 4 precedes residue 122, intron 5 precedes residue 137, intron 6 precedes residue 163 (InfoCard)
Promoter:	not yet available in the data library
Gene copies:	not yet available in the data library
Alleles:	no alleles are currently stored in the data library
Chromosomal localization:	not yet available in the data library

Interspecies Sequence Alignment



                                        |-helixI-|--loop1----|
                                         En**nn**nX*Y*ZG#Ix**z 

CHLAMY  :    MSYKAKTVVSARRDQKKGRVGLTEEQKQEIREAFDLFDTDGSGTIDAKE
HUMAN   : MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKE
MOUSE   : MASTFRKSNVASTSYKRKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKE
 

         |helixII|      |helixIII|--loop2----|helixIV|
          n**nn*n        En**nn**nX*Y*ZG#Ix**zn**nn*n
 
CHLAMY  : LKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKMGER
HUMAN   : LKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEK
MOUSE   : LKVAMRALGFEPRKEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEK


             |-helixV-|--loop3----|helixVI|      |helixVII|
              En**nn**nX*Y*ZG#Ix**zn**nn*n        En**nn**n

CHLAMY  : DSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEA
HUMAN   : DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEA
MOUSE   : DTKEEILKAFRLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEA

         |--loop4----|helixVIII|
          X*Y*ZG#Ix**zn**nn*n

CHLAMY  : DRNDDNEIDEDEFIRIMKKTSLF 
HUMAN   : DRDGDGEVSEQEFLRIMKKTSLY 
MOUSE   : DRDGDGEVNEEEFLKIMKKTNLY

Sequence alignment for the entire calmodulin subfamily

Functional Information:

General information:

no general functional information is currently stored in the database

Biological roles:

not yet available in the data library

Disease states:

not yet available in the data library

Target molecules:

not yet available in the data library

Structural Information:

Calcium-coordination:
not yet available in the data library

Nature of the conformational changes:
not yet available in the data library

Secondary structure: (as reported in the PDB file and its accompanying reference)
not yet available in the data library

Additional structural information:
no additional structural information is currently stored in the database

Available structures: (follow the links from the PDB code to the retrieve the PDB files)
no structures are currently stored in the database

Information about mutants:

no mutants are currently stored in the database