ELF@, 44 (4@4@44@4@4pH@H@Hp@@@@''p@@ 0/L/usr/lib/libc.so.1 0@ @@t   ppdp@p p(p'p pppp_p&p%p%;p-rp)@Hp @:Ip$@!p@"xp/Dp/:5'4\BI5JIQS.text.init__Argv__rld_obj_headexit__start_environ__istart__readenv_sigfpemain_mcount_gp_disp__Argcdiefprintf__iobper_res_rmsdNAB_rnextNAB_rriNAB_strcpysprintfNAB_readstringrmsdprintfmake_rot_fnamesplitNAB_strcatcheck_input_molNAB_mriNAB_strcmpgetpdbcountmolatomssuperimposesqrtNAB_mnextNAB_ariNAB_arfputpdbNAB_rrc.rodata.bsssubstrstrlenmallocstrncpygetlinefgetsstrcmpstrspnstrpbrkstrcpystrchrNAB_indexNAB_newstringsetframesetpointsetframepalignframeoverlayfreeselect_atomsmatrixvectorjacobieigsrt.datanewmoleculert_errormsg_sfreemoleculeaddstrandupd_molnumbersaddresiduecopyresidueconnectresmergestrcopyextbondscountmolstrandscountstrandresiduescountmolresdistdistpangleanglepacosgetresnamesetreskind__ctypetolowersetxyz_from_molsetxyzw_from_molsetmol_from_xyzsetmol_from_xyzwNAB_anextNAB_arcNAB_arpnewtransformcossintransformrestransformmoltransformptsupdtransformtrans4pNAB_matcpytrans4rot4prot4hypottorsiontorsionpcapset_belly_maskset_cons_masknrerrorivectoripvectorimatrixfree_vectorfree_ivectorfree_matrixfree_imatrixfabsfopenfclosegetpqrgetciffputpdbputciffputcifputpqrputbndputlinkin__us_rsthread_stdio__semputc__flsbuffputlinresputdiststrncmpsscanf__assertrt_errormsgrt_errormsg_2srt_errormsg_dgetreslibkindgetenvsetreslibkindgetresiduestrstrstrcatcopyparmcopystrandcopymoleculedbDBRndOpenbDBGetValueDBZeroPrefixDBPushPrefixbDBGetTablechirvolsDBRemoveSpacessDBRemoveControlAndPaddingsDBRemoveLeadingSpacessDBRemoveFirstStringdDictCreateDictDestroyDictAddreallocvPDictFindvPDictDeleteziDictKeyComparedlDictLoopqsortvPDictNextGiDBLastErrorzbDBParseSimpleHeaderfseekftellfputsCompactDataBaseunlinkrenamefgetcDBClosebDBRndDeleteEntryDBRndLoopEntryWithPrefixbDBRndNextEntryWithPrefixdbDBSeqOpenDBSeqRewindDBSeqSkipDatalDBSeqCurPosDBSeqGotobDBGetTypeDBPutValuefflushbDBGetTableTypeDBPutTableDBPopPrefixDBPushZeroPrefixstrtokclear_attrset_attr_ifcompilestepregerrsednbraloc1loc2locscircfadvancelibm.sosgi1.0libc.so.1sgi1.0_endend_edataedata_etextetext__elf_header_ftextftext_fdatafdata_fbssfbss__program_header_table__dso_displacementAFj)`0!(,| ;lH:}_&>N"5.1=*Em+2oa- MR/k@q4h%z~eD'G$<fJ{^p7nu cUI3 sLB6Cw#dS iv[Q98?r\KOPWbygTVYXZ]xt@, pB a*@2:@i>0/}@@4@)@)3@)(@, X@-< n@U@0@Vp@Zx@^p@_P8@`@a|R@`@<@@l@p@h@h@H@@,#@<3@D@T@0e@h|o@w@`(@,@$@@p\@ǀ@ɴ@@ @l@<l-@5@>@DR@HP_@k@ @@0A(AA,AA `0%A5|4A6<tBA6WA8heA:ASLApl AdA\6APAhAvApDATADAAA0 AD`AAژAhpBwB@@c@j@/D_/LZ/L`|0#@)B@)t@)@@)t@)4u@)|@)@)@*  @*D@*,d@*<d@*L@*\,@*l@*|@*0@*@*@*x@*D}@*@*|@*@+ @@+ @+,t@+<P@+Lp@+\w@+l\@+|@+@+@+\@+@+@+@+@+@, p@-Pd@-@/<@0S@2"@W`@[@\@]l@^D'@g $@k0\@n @{ 8@`_@Px@X<@@(@`@8@@@8@Y@B@tJ@ i@@@@@<x@άt@(%@`@@F@P$@ +@Lx@RAL<AA(A1A4lDA5Lt~A?PAGP APAhAXA4'A<APHATA(dAoA|ApLALAtA(A@Ad\A4AL8A0A8dA͜AΤP AϠA A42AL 9B; ////"/ '/$,/, /@i/H554I'$ х]mj:l4 0%`   Ke ͂ s pThN%МτcL UKL%QBWXXXXX S  # dt i.iQ[ `b˫ˮb8xU4 Xܷܩ|||D 0F>ʰrc1WT4D 4',e *(xh  }nA Ů  \ U0h1)Ϧ\l\leɣɣ[kwOtlD\Dee`R ]Z .% y yy83S J lܳ@n iyصzc cmjcypdǓmf6 ӟ J0FܬV3#xmm,m|0KH5lܣ<[j H8e iu7zs-U Y̒_fe ρE3k diXdXiXiXXXX%c=  Vyg= ;s˫b8"ܶ| * | | 1W1Wcn-" < Lws ND C | yT * jU #ħ e j6 ğ dpE TܒyI5a5b5jSS x% 4cx% 4dx% 4ex% 4fx% 4gx% 4hx% 4ix% 4jx% 4kx% 4lx% 4mx% 4nx% 4ox% 4px% 4qx% 4rx% 4sx% 4tx% 4ux% 4vx% 4wx% 4xx% 4yx% 4zx% 4{x% 4|x% 4}x% 4~x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4@%<'!%<8!T'$$$'0!<<!!T&<<!!X<0!$hXר@T PIP# PF(B$IP! P@ `! X%>0mp!hF*4hX`\ \\(, $'`$<' !'@@$$ '4 $P <'4 '4 <$ +! 88$'4H*X!e $T @% (%4 @%(% '4 8< %* 㯭8$4 $X @%(% '4 $ 4'@<'!'؏\(,$($d ,@%\$ $pX $'$ $|'$ % \($ $,@%\$$ $J K $'$ $'$ % \($ $ԏ,@%\$ $܌N $'$ $䏼'$ % '(<'8!(D(D NЏ(D8D0 N̏('H Nȏ(H4 Nď(0L N(,( N($ N,$C,$C8&8&8(8(8*8*$hP$L$ $ 0$` 0(H$8N+! H(L$)N$ P X!d $x@0(L N( px! $N0((N'"9N(L$N$P*X!d $@0(L N( px! $N䏼0((N'9N(L$)N$ P X!d $@0(L N( px! $Kp0$ ((N'9N()N(L$JN$ X h! $@0($ լ,Nď(L$N$!$$ @0($ Ĭ)Nȏ(L$N$XKh! $@0($ ,N̏(L$N$!$$ @0($ )Nԏ(L$JN$ X h! $@0((LN$ ,N!% ( $N菼0(()N%**N(((NNL%  x+Np! 0@%((N%)KxȀ)P!ZP((LNN(!% X%l%N  !0()N )(( JN%N @%  l !0@%(%(( N'R p%  !0(((9N$%JN (%Hp%kR+`!*@! $0((pN$%N p!(% $̏0(9N+! (P%H%K%)Kx ! i(!0(LhNP$ px!$  $0$` 0((HN'9N* (JN@?((X%kKxi(%)N( % N0(("NN-`($N $ 0@%`($N $.0@%xx# x$x!x@DD!%>0(P!PhX((N N0(("NkN`()N)!  8$$  $08&   %0(H(%Kx N0(("NN$($L N0@% (% 8 $ 08&   %0(H(%Kx N䏼0(("NN$($ N䏼0@% (% 8 $ 08&   %0(Np$$$ $쏼0$((% N@0p$ $ 0p$(($N N0$((% N@0p$ $D 0p$(($XN N0(($N9N) (($ kNج*N)a (((N܏()N%KxȀ.@!,N h`!(% 8%@0 8$$  $08&   %0(((JN؏N%Kx @ @#@Ȁ'. @! X(%i@x!X- !%i0!'9U0(9p!0%N(%8% @0 8$$  $ԏ08&   %0(((N؍N(@@#JN@(@!%@,N8Hx!X%)U0i!2$Џ8(F$N&(,F(B0C,F0T2C((h x%%%Kx%)Kxi(!  !0(((9N܏N'..N* y(((N؍N%,N * g(,(JN$CND0,F2!F( F T CDXDP8($ *8)N0Џ8F(2ȏ(+N)! 7(($Nج9N) %(((N؏N܏8 ``# ``! ` @!P%U0OX!f$ȏ8(F$2()NF*T*菁8N%9(8F(2(9N.* (((N؍N%8N* (8N&8% D F"F*0F  ؏(($kN/N)a ((()N%KxN Ȁ.h!,(% 8%0(((N؍JN%(NH* (($kN/N`((()N%Kx(% Ȁ-p!T8N( % N0(("NNzh($N $0@%h($N $0@%l($N $0P,P)%COX!h /h!F(($hN$4 0@%h($N $$0@%l($N $00D0*%x @! XlH!F&"($*hN$P 0@%h($N $@0@%l($N $L0P4x8%p!@ P!F(((RTNN 0(("NkN`(((N؏9N%)N)* h(%N 0(%(T("N(N N0(("NNel($N $h0@%h($N $\0@%(,@kN%C P!D0D(F2$$xF*$0lN 0@%h($N $l0@% (0 HN'9x9x!D(F$$F&A$lN 0@%h($N $|0@%(4@kN% P!DJ(F(F2R(TNN 0(("NN($)N!p$ $0$((N9N) p$ $ď0(((N؍N%8N* p$ $̏0$ ((JN-N@>p$($ N؏0$ ((Nج+N) (((9N؍)N܏$xx#xx!xp/p!%U0h! $؏0(((JN܍N%K+Nl* p$ $0(((9N؍N'))N* p$ $䏼0$((N.N+ p$ $쏼0(((N؍JN% -N* p$ $0p$ $0$ ((N+N) p$($ N؏0(((9N؍N'))N/* p$ $0(($N.N4(,(N؏((')0%70h%/p!%kKx%N(%8%K ! $N0(,8N%J70$hX!f8(F$4(N0j,9NF*T(C,%F(&C((N(* (,()N$CND,FF* F 6 CDD8$28(8F*A&( .N؏(,8N%J70$hX!p8(F$(NF22菁89N%*8F*A&((N(* (8N08%D F$F2F  ()N |p$ $0$((N8Np$ $00(((JN؍N%K+N* p$ $80$((9N(N (,pN؏$%)70p! $<0(((N؍kN%*Nj* p$ $D0$ ((N,Np$ $H0(((9N؍N'//N* p$ $P0$ ((N)Np$($T N؏0(((N؍kN%*Nj* p$ $\0p$,,$`C C0(N p$88$ ܏0p$,,$C C0(N p$88$ 0(9N c( N菼0(("NN (($N $Kx0hP$($ $ N菼0$` 0((,N(%)Kx&(%8% N0$((N8N4((,JN'9N䏈( (% 8%0 x(%%=p X%l.!%Kx ! $N0(,8N%=p* Xl@!8(F*A(9N&,NF$$2C,'*F2(C(*N* (,()N*CND0,F1!F$PF 6 CDD8$0828F$(( 8N؏(,8N%=p* Xl@!8(F*4(9NF00菁8N'*$8F$((*N* (8N&8%DPFT!F00F  ()N ~p$($( N菼0$ ((kN-N`p$ $T0(((N؏9N%(N(* p$ $\0$ ((N*N(,pN؏$%)=p h! $`0(((kN؍N%l,N * p$ $h0$((JN9N@p$ $l0(((N؏N%.N* p$ $t0$ ((N)Np$($x N؏0(((kN؍N%l,N * p$ $0(9N  ( $N菼0@%(% ( $N쏼0p$(($N N쏼0((N N0p$(,,$NC Cď0(JN@ p$88$Ќ 0(N!(($N.N((()N%Kx%kR h!%`! 0(((JN؍N%O/N* (N$($ N0()N p$ $0(%X(( N N0(("NkN``($N $80@%`($N $,0@%`($N $0@%`($N $$0@% (( hNh# h$D h! h@!F"!P%>0Op!hkIF( ``# ``! `@,h! @!($$PF  hdN 0@%`($N $X0@%`($N $`0@%`($N $l@% 08 pp#p$p!p@X! H%>0p,h!ժh$eF $@0X((N N0(("NN` % 40 $(,'H%<'f!'Џt048 04,,* hP$4$  $*%,48@#% ** (8x8 $$$` hP$$  $%40|$(!$ 8$8!$'0<'e`!'؏(8($ $0@8%0$$$ !$% $*@8$B0%'(<'d!'@@DH%$H $@4$H $ȏ@%Ht P$444^@<00H 0HH!,,K`<,H (($,p#8  X+`!L+ TA@#@P! XD`iX# X`! xզhx#x!& PpHP# PH!( %%l L* 'I * l'<'H!'诠 dS3(J  FK hmp!(3(3L/*T YlX# XKh!1  դ`xx#x! P&hLP# PX!f hph# h@! % %,KL* %(* '<'F!'诠 dG >  X+`!L+ TA@# X@iX# XP!`!ՄD` pp#px!&h @@#@H!(hp %% L* '+ * @'<'E\!'`88x'`%HH!!$&'X!F&"88'hh'9x% h!@! x!F0T%K)a ௫''h'9yx ' $''P@! H!$%)A ' 'P'9yx '8'h'8 `!&!%)! '8' '9yx 'P'P$'9zX '8$'9zX ' $'9zX 8P%k0Kp!*`!%+ 8'P H%0.!/X!j0F0TI`!%+ ﯸ8'8 x'90P!p!FF&"/`!0%+ ﯸ8' X%J0jH!n!*0F0T`!H%+ ﯸ'<'BX!ԄԦԊ԰F&"F0TF2AԆԪԲԈF*4F2AF$F 2ԲԈԦԄF2DF&"F*<'A!D(D '  װ x!!(% &*F(2 F* נ'<'Ax!'@@$D'9y쯼 D(%  %F F D8D0 8פ8F& 2ED44@ת8@H!(F*D04D%Kl* 4$״'@<'@!'H,''x''9}l(' (פצx'9 (''''9}l '(רת'9 ('0'9 ď('0'9 (װפרF F !F BDD'9 (װפרF F !F BDD'9 ď,('<'>!'xx#x!@H!$P!HX!d%) %&* ꯹'<'>d!'(D(D D8D0$$ ,@ ( PX!lDPFT!F0D px! Ȁ-#D H!F!*F*2F( X`! pp#D px!F!F*4F0D $ ȀH!+ ``#D `@!F! PF*2F(R %* ¯ (D8D0F& 2EF$T( 2(F2A&($դjF$Tp'<'<!'$צxx#x!!F&"(װH(H# HP!JX!F0Trצ hh# hp!!F&"%$* ޯ'<'<!'GD(D װxx#x@!H!P!H&X!h`!F&Bh!p!!!F*װ%*)AըՄF$AF&װ02F2AF$ ת ``# `h!רpp#p!(ײ#H!2%Kd* ' <':!$'p,:( $$$ $($$$$$ ":($$$ ":($":D(#D @H!'(*X!d%) %) ꯯ 9H P!KhD0h# hF2!p!! F*DPHP# P h*X!mp!Ȁ/#F2-!'(H!&-P!H`!F$2%n) ֯%+ Я%9-* ɯ'(JP F@<@F0TDD'F21'(''(F$xH''('F(B'(''(F&T$$$ՈՐDDF0A''($dרx 'F(F*Q'(F01 0''(F2R(0(&8D@DHF01'' צxJ@$F&DF*T'F0(Ո8Պ('F(Qf00$F0DD8 $F(Q&@2HJ:հ$H'؏$k:Ք'؍n$:$9:4'؏-$J:H$k:Ք'؍n $:$9:4 '؏- $J:H$k:Ք('؍n $: $9:40'؏-$J:H$ k:Ք8'؍n$:$ 9:4@'-J:H  k:ՔHn : :: :($$$: :($'89: P X*@! nx!Մ' )! $'8'*A@% hjq@x!'X P!J'8`X!hq@F AH!'X*@!'8 h!2q@HP!'XH`!'8'X Xyx! @H!0'8'X @ X!dx!F "`%+ '8'X(x'Xy@h!ղ `@!`F F01pq@ P`!'X y@ h!p!!*צpF(T%L)F24 p XiX#פp X+x! @!%)A ͯ%)! ǯ,״ '<'3@!x'د $x$$ $$$$0 $T=%D(D $D8D0$DHD@$<?DX($DPDD $DD0 $D D(R($D8D0d0$D@DH8$DPDX@$DDH$DDP$X$ `$d$ h$@p$`t$'(<'1!'HH%H@dD@  % D   % D0K`dD0x!<(8 ((* % $$`(<@ % <H % <P  % < T,8 L 8l\ % ,8<%%x8,*L* < T  % <`` % 0D%0* D- % DD@  yD@`` % Ht*4 % 4  % 4@@ % 4   % H dtH %'H<'.!x'Я04 $ ,,l8$4$ $d$$8$t $簏]$t4 $O$x$ l8$4$ $$$8$ $簏;$ ,,4 $,@,`0, ,,,, 0 ` , d0ld(((,(90H`% K`p0 0%p'0<',x!'ȯ88<@0d44< @404  40@ $$< $ԏd$0lmCx%   ,,l8$0$$ $$8$  $簏B%0$(0$,* `!Lh!$0'($+ * 0MD  00,ď@ 0((+( h P!Y0(40' p8 8%`p'8<'*<!'XX,(\`dd TT\ @(T(TT $$\ $0('$`@Tl* l8$`\$ $L($$8$d $簏( $T`$ !(<8HHjL@H<Tqp#p!@X d@(< 8<H% E`!Պ%* ﯮ 0x@!XH!0 ײ$ `h!" x@! H`! P!DX!x@! P!Fר ph!x/X!h' * ௩ %L* '<'!'د((P"$$( $"@@P$$( $"D$$hP$($  $"H$` $'9$ $ P*@ %  '(<'!'د((P"$$( $"d@P$$( $"h$$hP$($  $"l$` $'9D $ P*@ %  '(<'!'د((,P"$$( $"@P$$( $"$$hP$($  $"$` $,'9" $ P*@ %  '(<'!'ȯ<<,( 8hP$$  $"(9%$8 $"@(P%4$8 $"ȯ44( $$8 $"̏($` (<$4(%$8% (4P%Kl % (%,'8<'H!'د00( ,hP$$  $"䏼3%$( $"@P%$$( $#$$ $$( $#$` $, 0$P% *@ % %'(<' !'ȯ<<,( 8hP$$  $#((%$8 $#444( $$8 $#8($` (<4$0%8% (4 (%,'8<'(!'\\X, (hP$$  $#P%$X $#hTT $$X $#l$` \0d PP0P* X!0Px0  (( $$$$# $#$,\D0d :P0(D X `!P,D$ *L8@!D)! 08(D!xO@! P88m pD!P% *L8`!D-m* P0x!0PLȯP\0 d iPP8m[P80x(P!L(H! X!L$H<L$HY@H$)h!hT$#x0! 8!$L%$H<* L)8 % 8m* 408(4 P! x!) h! p`!@ $< T)0!h$# 8!  mݯ 8P%8* P0P8P!0mP( % T ,'X<'!'LL$,(H$8 4hP$$  $#Џ(%$H $#쯢DD( $$H $#($` (h$$D$$ $$ (Dh$$$$$ $$((X9 $ D (D %* Dl$ `(%  (D$ D') h$D $$@(D0%h$8% $$DL<(Hd^@EA<, ) <8 )! 7@ X+h!< % 8D, Ȁ9X!n8M %$H $ר(*(hF*@>E< ) 8 )! @pX!y< %  8D/ 8p!8+ %h( @H%M@L* ~DH' DL%h* F'H<' !Ԅ`Ԧ`'F&"԰hԊhF0TF(DԦpԄpF&"F2F*R'F$F(0F <'!'xD@ a$na${aVt$t'8Ett$ t% >t@)  $+'9  (%@L$J@@Lt@%L8tk%t t%%t-L'P+ $*'9  (%t$ tL%h%tLOtH%' tH``n5j8&<*!0 *!: <@@!@@h!% <$'9  (%&:3\+`$,!<+ $ '9  (%<t$,t%!t8`%%o` 8$,'9  (o%&:3\.s`t$t'8t&&:s}+` $-'9  (R%8 <tt%Ktt1 38* $.'9  (8%$$'9  (0%<) $ *!1 *!: H&1,* $'9  (%t$$Nt%htt%Ntt$`t%,tt%Bt, $'p<'Ÿ!P'Я00D$ 4., %4 2 4$!0 0 ,04 @ 0D$*0q%l0 %,04 @ 0D$-0%0 %$'0<'Ą!',(HL$ L%%L&x/* $8!89!HL(*',%+ &.sL`毬H%H%H`%H%HH$(H$LQ%IH%;2.!y`! P$@%i L%$H1',H23.s` $Lx2-%J;X!!i($+r& L%L%LDH %k PKH!/L%LLDH%JhX!lL%LL%L %'9, (DD0%%`80H%HQ&+`Q%DDk0`%%o`/0DDH)4 %%(`(4H.'8Hј&+`DDJ4@%%M`-4D4H%oHL%(LL'9, (DD0%%`90H' H.s`%DD0%%`,0DDHk4`%%o`/4H3%(H.s`DD4%%`94D4H%MHL%bLL'9, $ (DD0%%`)0H$L%H%k;2,x!8P!M-@$%DD0%%`90DDH4%' `*4H$L%H'9;H2.!h! H`$DDk4`%%o`/4D)4!H%HL'8"L$L'9, $(DDJ0@%%H` (0H%H23+` $LH29';8P!h!H$.sr`&t%DDk0`%%o`/0DDH)4 %%-`-4H1'8H23+` $L@2+%;oH!Hp!-$.sr& DD4%' `*4D4H%HL%LLDD'% Ȁ8P!H%H<<XoH!,L#4ď4 @(H4NX!9H%LDD%% `!-H%< % (%PNX!iįL-`#44 <@ (H4ď< p!HH 4@(Hp+ ,HL @($H4-`#HH+ %H%H`Q%H' H`IHLi%H-&.s` %LH8'*H&.s`L%i1LHH$L%H%J;x29*X!@!i8h$L% L$HH%H23.s` $LP28%; p!*X!i$+rx&L%LH%KpHL$ H ,HL @(r$H +%/`ﯯHk%L$$! D X%m!H1 ,HL @(R$H+%`ﯹHK%LHJ ,HL @(=$H +%m`H6%DHLH\)x!3($_!)P!K1mH\.`!1 $_!.@! 1*@.%H\q-! 1$_!-!.1%, $'H<'!D'1/0$$0D$N 84DD90@#(4'%s resnumstrandnum%d:%d:%sWarning: per_res_rmsd() couldn't find %s ...rot.pdbnstrandsnstrandsERROR: Molecules differ. Bye.nresiduesnresiduesERROR: Molecules differ. Bye.natomsnatomsERROR: Molecules differ. Bye.%s [-mat] [-rot] [-mean] [-sd] [-cmp pdbfile] [-pr atom_sel] [-fit atom_expr] [-calc atom_expr] pdbfiles -fit-calc-pr-mat-rot-mean-sd-cmpMolecule %d = %s --> %s Molecule %d = %s Cannot get pdb file %s. Bye. strandnumresnumERROR: At least 2 pdb structures are required. Bye.ERROR: No atoms defined by the fit atom expression ERROR: No atoms defined by the calc atom expression -mean : Mean structure will be output to "%s" mean.pdb All atom fit. -fit : Fitting on the atom expression "%s" : %d atoms. All atom RMSDs. -calc : Calculating on the atom expression "%s" : %d atoms. ERROR: superimpose() failed. Check your atom expressions.ERROR: rmsd() failed. Check your atom expressions.tatomnumxtatomnumtatomnumytatomnumtatomnumztatomnumtatomnumxtatomnumytatomnumz Pairwise difference matrix by molecule number : --------- %2d |%6.2f ---------- %6d Difference from mean by molecule number : ------ %6.2f ------ %4d RMS pairwise difference between structures = %5.3f Standard Deviation = %5.3f RMS difference from mean structure = %5.3f Standard Deviation = %5.3f ERROR: -cmp: Cannot get pdb file %s Difference from %s by molecule number : ------ %6.2f ------ %4d Rotated %s will be output to file %s RMS difference from %s = %5.3f Standard Deviation = %5.3f mean.pdb per-residue RMS differences: strandnumresnumstrandnumresnum%4s %5d %8.3f resnametresnumstrandnumresnumsubstr: pos (%d) not in string substr: can't allocate substring NAB_strcat: can't allocate new string NAB_strcpy: can't allocate new string NAB_readstring: can't allocate new string can't allocate new a_pos array can't allocate new a_pos array can't allocate new a_mask array superimpose: atom mismatch: mol(%d) & r_mol(%d) can't allocate new a_mask array can't allocate new a_pos array can't allocate new ra_pos array rms: no atoms selected in mol 1 rms: no atoms selected in mol 2 rms: atom mismatch m1(%d) & m2(%d) rms: can't allocate new a1pos array rms: can't allocate new a2pos array setpoint: %s: no atoms selected Unable to allocate space for %s. new moleculenew strand %sUnable to allocate space for %s. name for new strand %sUnable to allocate space for %s. Strand %s not in molecule. residue array in strand %s Unable to allocate space for %s. Strand %s not in molecule. #%2d not in strand %sResidue %s. %s not in residue %sAtom %s. #%2d not in strand %s Residue %s. %s not in residue %sAtom %s. bond between %s %d:%s and %s %d:%sUnable to allocate space for %s. bond between %s %d:%s and %s %d:%sUnable to allocate space for %s. lastfirstfirstlast%s/%send1/end2 in ligate() must be be 5'/3' or 3'/5 not %s Strand %s not in molecule. Strand %s not in molecule. Unable to allocate space for %s. merged residue arrayanglep: p1, p2 are coincident, returning 0.0 anglep: p2, p3 are coincident, returning 0.0 dnarnaaasetreskind: ERROR: unknown rkind %s nstrandsnresiduesnatomsNAB_mri: unknown key: %s resnumtresnumstrandnumNAB_rri: unknown key: %s resnameresidstrandnameNAB_rrc: unknown key: %s strandnumresnumtresnumatomnumtatomnumint1NAB_ari: unknown key: %s xyzchargeradiusfloat1float2NAB_arf: unknown key: %s atomnameresnameresidstrandnamefullname%d:%d:%sNAB_arc: unknown key: %s copied external bondsUnable to allocate space for %s. Strand %s not in molecule. PO5'O5*O1POAPO2POBPHBO5'O5*HEO3'O3*C3'C3*HEHECan't create new atom array Can't create new atom index array @Lc?FR9?FR9?FR9?FR9?FR9?FR9?FR9?FR9?FR9?FR9?FR9?FR9?FR9?FR9@ !TD-@f@ !TD-@f@v?Q?pXK?Q?pXK?QFATAL: %s allocation failure in vector()allocation failure in ivector()allocation failure in ivector()allocation failure 1 in matrix()allocation failure 2 in matrix()allocation failure 1 in matrix()allocation failure 2 in matrix()?ə-rgetpdb: can't open file %s -rgetpqr: can't open file %s -rgetcif: can't open file %s putpdb: NULL molecule -wCan't open file %s. putcif: NULL molecule -wCan't open file %s. putpqr: NULL molecule wCan't open file %s. putbnd: NULL molecule wCan't open file %s. Unable to allocate space for %s. aoff array in putbnd%d %d %d %d putlnkin: NULL molecule wCan't open file %s. %s nab generated structure%s -- amber db.file -- DU %5d%5d%5d%5d%5d Strand %3d: %s %c%4d%5d%5d%5d%5d QUIT putdist: NULL molecule wcan't open dist file %s %3d %-4s %-4s %3d %-4s %4s %8.3f %-4s%dATOMHETATM%d%lf%lf%lf%dTERENDATOMHETATM%d%lf%lf%lf%lf %lf%dTERENDgetcif routine not implemnted in this version! fputpdb: NULL molecule fputpdb: NULL file pointer ATOM %5d %-4s %3s %c%4d %8.3f%8.3f%8.3fATOM %05d %-4s %4s %c%4d %8.3f%8.3f%8.3fATOM %5d %-4s %3s %-6s %8.3f%8.3f%8.3fATOM %05d %-4s %3s %-6s %8.3f%8.3f%8.3f %10.4f %8.3f TER HBHEHEH5MH7C5MC7molmolio.cfpmolio.cdata_%s ########### ## ENTRY ## ########### _entry.id %s ############### ## ATOM_SITE ## ############### loop_ _atom_site.id _atom_site.label_atom_id _atom_site.label_comp_id _atom_site.label_asym_id _atom_site.auth_seq_id _atom_site.cartn_x _atom_site.cartn_y _atom_site.cartn_z _atom_site.label_entity_id _atom_site.label_seq_id %5d %-4s %3s %c %4d %8.3f %8.3f %8.3f %3d %4d ?333333?NABHOMENABHOME not defined getreslibkind: unknown reslib %s UNDEFdnarnaaaUNDEFNABHOMENABHOME not defined getreslibkind: unknown reslib %s dnaDNArnaRNAaaAANABHOMENABHOME not defined ADEDAGUADGTHYDTCYTDCADERAGUARGURARUCYTRC3355%s not in library %sResidue %s. new PARMSTRUCT %sUnable to allocate space for %s. copyparm AtomNames %sUnable to allocate space for %s. copyparm ResNames %sUnable to allocate space for %s. copyparm AtomSym %sUnable to allocate space for %s. copyparm AtomTree %sUnable to allocate space for %s. new residue %sUnable to allocate space for %s. atoms in new residue %sUnable to allocate space for %s. atom index in new residue %sUnable to allocate space for %s. bonds in new residue %sUnable to allocate space for %s. chirality in residue %sUnable to allocate space for %s. new strand %sUnable to allocate space for %s. Unable to allocate space for %s. copystrand pointer arraystrandname %sUnable to allocate space for %s. copymoleculeUnable to allocate space for %s. .libleap/%srCan't open residue library %s. rCan't open residue library %s. new reslib %sUnable to allocate space for %s. name for new reslib %sUnable to allocate space for %s. .lib%s %s typednarnaaaatomtypeunitedalloffpdbrpdb file %sCan't open file %s. bndrbnd file %sCan't open file %s. qrrqr file %sCan't open file %s. chirchi file %sCan't open file %s. %-*.*sIncorrect line in residue library header %s... ./../%s/reslib/%s!indexentry.%s.unit.nameunit.atomsunit.positionsunit.connectivityREMARKATOMHETATM%s %d %s %s %d %lf %lf %lf# %s%-*.*sIncorrect header line in bond file: %s... %d %d%-*.*sIncorrect data line in bond file: %s... # %s%-*.*schi2reslib: bad line in chirality file: %s chi2reslib: res %s not in %s %s %s %s %schi2reslib: atom "%s" not in residue "%s" chi2reslib: atom "%s" not in residue "%s" chi2reslib: atom "%s" not in residue "%s" chi2reslib: atom "%s" not in residue "%s" REMATOMHETATM%s %d %s %s %d %lf %lfREMARK RESLIB %s %sDNARNAAAUNITEDALLATOMresidue %s in reslib %sUnable to allocate space for %s. atoms in residue %s in reslib %sUnable to allocate space for %s. bonds of residue %sUnable to allocate space for %s. %s not in reslib %s Residue %s. %s not in reslib %s Residue %s. addchi2reslib: can't alloc r_chiral for %s addchi2reslib: res %s not reslib %s ?UUUg?UUUgAn error occured in line: %d Message: %s ! singlearraytable intdblstr int dbl str %s !%s %s %ssinglearraytableUnknown modifierintdblstrUnknown entry typeTried to parse:%s: as a headerWARNING: Nonunique entry in database: %s found %d%lG %d 0.0 %lf %lE %cUnknown value type: %d Unknown value type: %d t9423848wCould not open scratch filer+rr+w+Illegal database open mode The DATABASE has the wrong access mode.DATABASE is read-only!rr+w+Illegal database open mode The DATABASE has the wrong access mode.The DATABASE has the wrong access mode.Illegal read of sequential file after a writeDATABASE is read-only!When PUTing into a DATABASE there must be a MODIFIER!When PUTing into a DATABASE there must be a TYPE!%s intdblstrIllegal table type!DATABASE is read-only!Too many prefixes on stackToo many POPs from prefix stackToo many prefixes on stack@@?6C-@@@@@,@T@|@AA@AhAAselect_atoms: atom-expr too complicated :::,,,,,atom range not allowed ,atom range not allowed *Range endpoint too large. Bad number. ``\ digit'' out of range. Illegal or missing delimiter. No remembered search string. \( \) imbalance. Too many \(. More than 2 numbers given in \{ \}. First number exceeds second in \{ \}. [ ] imbalance. Regular expression too long. Unknown error %d A,A.A.A.A.A,A.A.A.A.A.A.A.A.A,A.A.A.A.A.A.A.A.A.A.A-A.A.A.A.A- A-@A-`A-A.A-A.A.A-A-A=4A;A;ADA;A=A< ACA;A>ABF XE30US#PPS "02#00 "@B "@@U5(5!& &$PP"6$"6% !&&v#&&v#&(&AH!$!!#!"PS PS PS PS `c$ `c$ `c$ 00034AP%QPPPS PSӁ ```c0& !06%555555555570  '0" $'(4S!  ''(2H$E#30! !550 @E!3E0 @Q2!"$"#B X4DD!D B#!$(#$0UG3 D &$#&1F5 8!5!3!1@10318HC!3E!3E1S@51SA  %11  $3A@0@(!@0("CD#&!4#&!D&!D 10'11$ _ G=   03d`=S`@Ye1 (ltFH8RHZ0->0L(DQv@X$8N(c qHn (&  A( f0(Oa8 N ls, Py!@ XG<ϐPNu\Wz)6Fd_wt$ɐ|(!#"(%0@.7't>O)hU\+fv-~ |/ !1m0 ;(Qu`XHz.00|8  AXo@ Hw(h 0&8,=6PDIXVOUnh]c\pq !'H #81 L%8K"'8 f#)8&%T+ U,W'P- ^(/ 6)T1 U *3 (,6 (,8 90/; ,M1> D|3[e3@ bf3B (k5D `t9hGZ`:Ip SP05^?xUސP<LeA$XIPTZyAZk`hB$\d0XqEX^VF`DIbd(aJd0uKf'LHh-8M jH=DMldHJ[Nn`eOp0jOrXStWpvܐ(Xx Zz@L^@|@}_~@ $(`(,2 8(7=`X(BH  x0Ne+ 0jNH R qf |z p , (WiF(n0("L Ӑ85 "(Gl8XX"g H(K`0SHd$I ODQ TS% i & 1&h" 6' $ ȐHX*&  +( Đ#/* 83X, ֐(;4. 6xS %*l 16 8 >C\W JO! (_| n(82(8\i(Ha00[6@5}$ɐ(:B0Gi! Hu) ~  g*" ۴%0p1X$ V4 & H86( Ki<*Pz>T,4?|.ߐ0DL0HaG\2א0H47( 'I6g,P/dxl( q((P(2< ϐ(E (+7N\(FW\a(bno@8yx L & C( w  @(.L (d{ "F  h$Z  (& ((*ǐ I+D,Q ^OL.Ӑ(0(42 0<4O !(6i(7M8(_p:(P<Ԑ  => &@@0Ts!pB\("D0$F =("6%H { FP-&tJ (_k6'DL ѐ(D(N 1 f)hP Z p*R (w*DT *V (?Z+X w-Z E .\ (-5^ d 9 ;`  ,Db20 F,d  Ff   G4h͐    Gj  - 50Eg }8m.< o }   F'(+>BU>[n`(s{'<70A!@]#x8pt% -T xp+ ~0,ːH> , "(@,  0@,,/>@,/( K@-< K  ,  ,  ,  ,  ,  @,,    , < @-P  d >0oKpo"@- " /@/ /< >@0 > NKxoPNoWNo^NodNofNohNokNoqNoyNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoRoU0o70o=po CoCo2CoECoLxoS oZ,od,om,ox,o,o,o,o,o,o,o,o@2 , o" 8 ,  ,  ,  ,  , @U@ 0 @Vp ,0o !@W !` '@Zx ' 1@[ 1 <@\ < G@] Gl R@^D R a@^ ap  ,  , 7 ,0o,Ho,`o,xo#,o):@O2@_P ;@_P 28 D@` D N@a| N Y@g  Y$ e@k0 j@_P e\ s@n s |@p8 | @qL8  @rl8 H @s8 !x @u,8 #H @vt8 % @yx8 't !@y8 )l #@zX8 + %@{  - '@|8 /| )@}l8 1 +@8 3 -@8 58 /@8 7:O:O:OT 1 ,  , ,o@ ` @ ` *@P * 4@X 4< ?@ ?< J@ J S@l S c@ cp w@h w @@ !( @h # @ %` @H ' @ ) @ +,o @, - !@< / #@ 1 %@ 3 '@0 5 )@ 7 +@ 9 -@h ;| /%@ =%8 1-@ ?5,o- 3<@ A< 6D@t CL,oD 8S@  E[,oS ;]@ G] >e@` Ie( @m@ Km B|@ M,o| D@ O, G@$ Q I@ S K@p U,Ho\ M@ W,o P@ǀ Y S@ [,Ho U@ɴ ] X@< _x Z@ʴ8 a4 \@ c ^@ά et ` @  g b@ i( d@<8 k f$@8 m$ h/@հ8 o/p j8@ 8 q8$ l@@D8 s@L nL@א8 uL pW@؄8 wW r`@`8 y` tj@8 {j vt@8 }t x@8 L z@ l |@< l ~ ,  ,  @  ` @  @  "@ " +@ + 2@D 2 :@ :P F@H FP S@ S _@  !_  ,  @  @L x  , 1 ,o,o.o@  !@ ! (@0 ( /AL /< 6A 6( =A = DA K@ D, TA T ^A ` f@ ^0 oA !o zA$8 #z AD8 %` A"8 '` A#8 )d A#h8 + "A$ 8 - $A'8 /` &A( 1 (A,8 3\ *A0X8 5 ,A1 7 . ,  , A4  l A5L t 'A5 '| 6A6< 6t  , 9 .o.o.o /`o(/ho./o4/o8:O@;OH/oNA6 N \A8h \ jA: j uA?P u ~AGP ~ AP  AS L AU8 t AVH8  AW8 !A6  A`8 # Aal8 % "Ah8 ' $Aj8 ) &Am8 + ( Ar8 - L *Au8 /( ,#Av,8 1# .1Az8 31 0AA~ 8 5A 2NA8 7N 4WAL8 9W 6 ,  ,  A  h  , m Ap  l A 7Ap X <A4 < SA S hA hP tA t A ( A  A  Ap !L A #L A %t A|8 ' AL8 )d A8 + AH8 -@ A8 /P "A8 1 $A8 3t &/A 8 5/ (<A 7<( *RA8 9R ,`A8 ;`t .mA08 =mt 0yA8 ?y 2A8 Ah 4A8 C 6A08 E 8AP8 Gp :A8 IT <A8 K, >A@ M @A8 O BA Qd DAd S F#A\ U# H<A W< JVA YV LbA4 [b NnA ]n P|Ap _|D RA aT TA cD VAL e8 XA g ZA i \A k0 ^A0 m  `A8 od bA͜ q dAD s` fAΤ uP h A w j , (/o/o/o"/o(/o./o5AϠ 5 BAє8 BH OA8 O ZAٔ8 Z eAژ e pAۨ8 p }Aܸ8 } A8 h A08 h A !h A8 # A8 % Al8 '4 A8 ) !A8 + #A8 - % ,  A 8   /o/o"/(o*/0o./4o3;O:A BA  GA  :  OA O4 TAL \A  T aB,8 a`  ,   !   ; !  !  !  !  !    !  !   !#%')+-/16 !  !   !#%')+-/1368;>@BDGIKMPSUXZ\^`bdfhjlnprtvxz|~ !  !     !  !    "$&(*,.0 !  !   !   "$&(*,.02468 !  !  !    "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjl !    !#%' !  crt1text.sLOCALSZFRAMESZRAOFFGPOFF__start10$00000000001$0000000000_mcount/vince/6.2-mar09/root/usr/include/regdef.h/vince/6.2-mar09/root/usr/include/sgidefs.h/vince/6.2-mar09/root/usr/include/sys/fpregdef.h/vince/6.2-mar09/root/usr/include/asm.hcrt1tinit.s__istartsuppose.cdierms_per_resprexprper_res_rmsdmake_rot_fnamecheck_input_molmm_meanm_tempm_cmpraacn_moln_pairsn_fitatomsn_calcatomsprmatrotmeancmpsdijfitexprcalcexprcmpfnamerotcmpfnamepdbfnamerotpdbfnamepairwise_fitfit_to_meanfit_to_cmprms_pair_differencerms_mean_differencerms_cmp_differencemean_xmean_ymean_zpair_meanpair_sumpair_sigmadev_sumdevcmp_meancmp_sumcmp_sigmamean_meanmean_summean_sigmamain__st0001__/usr/include/stdio.h/usr/include/stdlib.h/thr/eigen/nab5/include/nabcode.h/usr/include/math.hstringutil.csubstrgetlinebufsplitNAB_indexNAB_strcatNAB_strcpyNAB_strcmpNAB_readstringNAB_newstring/usr/include/string.hframeutil.corgxtailxheadytailyheadgl_framesetframeclean_upsetframepalignframesuperimposermsdclean_upsetpointcount_atomscount_sel_atomsget_aposget_sel_aposput_aposmakeframecrosspdotpnormalizeoverlaycopyptscenmastransrotatelsqrotavd./memutil.hmolutil.ce_msgnewmoleculefreemoleculeaddstrandaddresidueconnectresmergestrcountmolstrandscountstrandresiduescountmolrescountmolatomsdistdistpangleanglepgetresnamernamesetreskindsetxyz_from_molsetxyzw_from_molsetmol_from_xyzsetmol_from_xyzwNAB_mnextNAB_rnextNAB_anextNAB_mriNAB_rrirv_errNAB_rrcNAB_arirv_errNAB_arffNAB_arcNAB_arpupd_molnumbersnewtransformmptransformrestransformmoltransformptsupdtransformmrtrans4pmattrans4rot4pmat5rot4NAB_matcpyraa2mattorsiontorsionpcapcopyextbondsmk_idmatconcat_matcopy_matxfm_xyzfixextbondsfreestrandcvt_p2hbadd_he2o3find_atomdelete_atomadd_atomset_belly_maskset_cons_mask/usr/include/ctype.hmemutil.cnrerrorvectorivectoripvectormatriximatrixfree_vectorfree_ivectorfree_matrixfree_imatrixjacobi.cjacobieigsrtmolio.cnatomsatomsresgetpdbgetpqrgetcifputpdbputcifputpqrputbndclean_upputlinkinputdistclean_upfputlinresfgetpdbfgetpqrfgetcifisnewresinitresmakebondsdistfputpdbmk_amber_rnamemk_amber_anamefputcif/usr/include/assert.htraceback.crt_errormsgrt_errormsg_srt_errormsg_2srt_errormsg_dreslib.clr_namen_atomsatomsn_bondsbondsn_chichinabhomereslibse_msggetreslibkindsetreslibkindgetresiduecopyparmcopyresiduecopystrandcopymoleculeknown_reslibread_reslibread_reslib_headerclean_upmk_fnameoff2reslibpdb2reslibbnd2reslibchi2reslibqr2reslibsetrlibattrsaddres2reslibaddbonds2reslibaddqr2reslibfindatomaddchi2reslib./database.hchirvol.cchirvoldatabase.csDBRemoveSpacessDBRemoveControlAndPaddingDONEsDBRemoveLeadingSpacessDBRemoveFirstStringdDictCreateDictDestroyDictAddvPDictFindvPDictDeleteziDictKeyComparedlDictLoopvPDictNextsDataBaseNameReportErrorConstructDataHeaderAddColumnTypeWriteDataLinezbDBReadLinezbDBReadDataLineeEntryCreatezbDBParseSimpleHeaderbScanDataBaseStripIntegerStripDoublesStripStringConcatIntegerConcatDoubleConcatStringzbDBGetValuezPutValueTransferEntryToNewFileCompactDataBaseePrepareDatabaseForEntrydbDBRndOpenbDBRndDeleteEntryDBRndLoopEntryWithPrefixbDBRndNextEntryWithPrefixdbDBSeqOpenDBSeqRewindDBSeqSkipDatalDBSeqCurPosDBSeqGotobDBGetTypebDBGetValueDBPutValuebDBGetTableTypebDBGetTableDBPutTableDBCloseDBPushPrefixDBPopPrefixDBZeroPrefixDBPushZeroPrefixselect_atoms.caexprspartrpartapartrexprexpbufselect_atomseval_1_aexpris_patternselect_allclear_attrclear_selectclear_workor_selectset_selectset_attr_ifmatch_str_patmatch_str_rangematch_res_patmatch_res_rangematch_atom_pataexpr2rexprregexp.cremsgbraslistbraelistnodelimlowsizebittabcompilenlimdefcharstepadvancestargetrngecrtninit.s.text.init__Argv__rld_obj_headexit__start_environ__istart__readenv_sigfpemain_mcount_gp_disp__Argcdiefprintf__iobper_res_rmsdNAB_rnextNAB_rriNAB_strcpysprintfNAB_readstringrmsdprintfmake_rot_fnamesplitNAB_strcatcheck_input_molNAB_mriNAB_strcmpgetpdbcountmolatomssuperimposesqrtNAB_mnextNAB_ariNAB_arfputpdbNAB_rrc.rodata.bsssubstrstrlenmallocstrncpygetlinefgetsstrcmpstrspnstrpbrkstrcpystrchrNAB_indexNAB_newstringsetframesetpointsetframepalignframeoverlayfreeselect_atomsmatrixvectorjacobieigsrt.datanewmoleculert_errormsg_sfreemoleculeaddstrandupd_molnumbersaddresiduecopyresidueconnectresmergestrcopyextbondscountmolstrandscountstrandresiduescountmolresdistdistpangleanglepacosgetresnamesetreskind__ctypetolowersetxyz_from_molsetxyzw_from_molsetmol_from_xyzsetmol_from_xyzwNAB_anextNAB_arcNAB_arpnewtransformcossintransformrestransformmoltransformptsupdtransformtrans4pNAB_matcpytrans4rot4prot4hypottorsiontorsionpcapset_belly_maskset_cons_masknrerrorivectoripvectorimatrixfree_vectorfree_ivectorfree_matrixfree_imatrixfabsfopenfclosegetpqrgetciffputpdbputciffputcifputpqrputbndputlinkin__us_rsthread_stdio__semputc__flsbuffputlinresputdiststrncmpsscanf__assertrt_errormsgrt_errormsg_2srt_errormsg_dgetreslibkindgetenvsetreslibkindgetresiduestrstrstrcatcopyparmcopystrandcopymoleculedbDBRndOpenbDBGetValueDBZeroPrefixDBPushPrefixbDBGetTablechirvolsDBRemoveSpacessDBRemoveControlAndPaddingsDBRemoveLeadingSpacessDBRemoveFirstStringdDictCreateDictDestroyDictAddreallocvPDictFindvPDictDeleteziDictKeyComparedlDictLoopqsortvPDictNextGiDBLastErrorzbDBParseSimpleHeaderfseekftellfputsCompactDataBaseunlinkrenamefgetcDBClosebDBRndDeleteEntryDBRndLoopEntryWithPrefixbDBRndNextEntryWithPrefixdbDBSeqOpenDBSeqRewindDBSeqSkipDatalDBSeqCurPosDBSeqGotobDBGetTypeDBPutValuefflushbDBGetTableTypeDBPutTableDBPopPrefixDBPushZeroPrefixstrtokclear_attrset_attr_ifcompilestepregerrsednbraloc1loc2locscircfadvancelibm.sosgi1.0libc.so.1sgi1.0_endend_edataedata_etextetext__elf_header_ftextftext_fdatafdata_fbssfbss__program_header_table__dso_displacement@, S J @@, S,  @@, - @@, 2 @@, )$ @@, J- @@-P<K  6A'@-PT%;h@-PV4@h@-P#XCEh@-P:ZRJh@U@Oo\ F a!Oh@U@qS@_Ps7 B9W*@_P &\I@ F&;aI<@-a^g @l//Pa m#m @E1kp$@*K14 m9r@ |ysA4 !D~ B ts,A6 ee9B;A6 =A UL{Ap mV5]yAϠ4(h /1A i\n Bo q"                    @, /BaO2:@Oi>0o/}@/@4/@)/@)/ 3@)(@,  X@-< n@U@  @Vp  @Zx  @^  @_P  @` @a| R@ @ @ @l @ @h @h @H @ @, !#@< #3@ %D@ 'T@0 )e@h /o@ >w@` @@ G@$ I@ K@p M@ǀ S@ɴ X@ ^@  b@ |@< ~-@ 5@ >@D R@H _@ k@  @ @0 A A A A A ` %A5 4A6< BA6 WA8h eA: AS Ap  Ad FA\ H6A JPA LhA PvAp RA TA VA ZA \A0 `AD fA jAژ A pB/wB/OO@O@Oc@Oj@O/Do_/LOZ/LO`|0#@)B@)t@)@)@) u@)|@) @)@*  @* @*, @*< @*L @*\@*l @*|@* @* @* @* x@*}@*@*@*@+  @+ @+,@+<P@+L p@+\ w@+l\@+|@+@+@+@+@+@+@+@+ @, p@-P @- @/ @0 S@2 8 @W  @[ @\ @]  @^D  '@g   @k0  @n  @{  '8@ _@P x@X @@ @ @ 8@ +@ -@ 1@ 3Y@ 6B@t 8J@  ;i@ B@ D@ P@ U@< Z@ά `@ d%@ @ @ F@ $@ +@L @ RAL A A( (A1 .A4 DA5L ~A?P AGP AP A A A4 'A <A HA TA dA oA |Ap A A A *A@ @A D\A4 NAL XA ^A8 bA͜ dAΤ h AϠ A A 2AL 9B;O /o/o/o/o"/ o'/$o,/,o /@oi/Hov @,,`I`` `O`k8`f`Le``*d`aX`#``}^`8]`]`%\`\hE@vt` [Hh0 @|h @|h@|h@|h@|h@vt`ZTh@|h^@|h@|`gTh@ph@qLh @qLh@sh @rlh@sh 8@u,`Ph@qLh@qLhO@sh@s`JMD`K$`(J`HId`RH`^F`RE\h-@yxh@yxh@yxh@zXh@zXh@zX`PBX`A`Axh( @y`)@hH @}lh@h @}lh@h @h @h0 @h0@` >`>d`k<`-<`N:`3@`X1`.`,x`*<`O%h 6@Dh@Dh@א`d`#`h`6`Jh` ``)`p$` ``h`m@`h`m ` `b h` `N`a0`5\```0`p` H`bh @(` `phA'`F@h&A,`?hA#hhA$ h:A#h $A$ h eA$ h >A$ `hA#hhA$ h:A#h $A$ hnA$ h?A$ `,``h`.h}A'`g `hVA,h A0X``x``````` h*AUh AVH`:hh+AUh AVH`RLh+AUh AVH`|`t`dj`hH`e`eh0 AWhAalhAhhAjh ArhAm`dhA`hA`hA`hA`h*A`h*A`h*A`h.A``W[(`1Zdh+Av,hnAz`ShAuh6Av,hUAv,`QhIAzhbAz`N4hJALh=Ah$Ah$Ah$AhJAL` IhKA~ h@A~ `F`JE`4@`=hA`BB,hQB,`A\6PAPAPAPAPA$PALPAtPAPAPA8PA`PAPvApPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA0PAPPAPApPAPAPAPAPAPA|PAPAPA|PAdPAPAPA|PAtPAPBPA|PAPA0>,/p@