| Additional names and abbreviations: | No additional names are stored in the database |
|---|---|
| Isoforms: | No information about isoforms is stored in the database |
| Yeast Protein Database Entries: | No links to the YPD are stored in the database |
| Basic Chemical and Physical
Information: |
|
| Number of amino acids: | 191 (all species) View a list of all sources stored in the database |
| Molecular weight: | 21.867 kD (all species) View a list of all sources stored in the database |
| pI: | not yet available in the data library |
| Number of functional calcium binding sites: | not yet available in the data library |
| Macroscopic calcium binding constants: | not yet available in the data library |
| Other metal binding constants: | not yet available in the data library |
| Protein stability: | not yet available in the data library |
| Post-translational modifications: | not yet available in the data library |
| Basic Biological
Information: |
|
| Source organisms: | Mus musculus
View an annotated list of all sources stored in the database |
| Tissues: | not yet available in the data library |
| Subcellular localization: | not yet available in the data library |
| Regulation: | not yet available in the data library |
| Genomic Information: |
|
| GenBank entries: | not yet available in the data library |
| Gene length: | not yet available in the data library |
| Gene structure: | not yet available in the data library |
| Promoter: | not yet available in the data library |
| Gene copies: | not yet available in the data library |
| Alleles: | no alleles are currently stored in the data library |
| Chromosomal localization: | not yet available in the data library |
|-helixI-|--loop1----|helixII-|
En**nn**nX*Y*ZG#Ix**zn**nn**n*
MOUSE : MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGT
|helixIII|--loop2----|helixIV|
En**nn**nX*Y*ZG#Ix**zn**nn**n*
MOUSE : WTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYIT
|helixV-|-loop3-----|helixVI-|
En**nn**nX*Y*ZG#Ix**zn**nn**n*
MOUSE : DWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQ
|helixVII|--loop4-----|hlxVIII|-hlxIX--|--loop5----|-helixX-|
En**nn**nX*Y*ZG#Ix**zn**nn**n*En**nn**nX*Y*ZG#Ix**zn**nn**n*
MOUSE : FHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Sequence alignment for entire calpain subfamily
General information:
Biological roles:
Disease states:
Target molecules:
| Calcium-coordination: |
|
|---|---|
| not yet available in the data library |
|
| Nature of the conformational
changes: |
|
| not yet available in the data library |
|
| Secondary structure: (as reported in the PDB file and its accompanying reference) |
|
| not yet available in the data library |
|
| Additional structural information: | |
| no additional structural information is currently
stored in the database |
|
| Available structures: (follow the links from the PDB code to the retrieve the PDB files) |
|
| no structures are currently stored in the database |
|